Protein Info for SO0102 in Shewanella oneidensis MR-1

Name: fdnH
Annotation: formate dehydrogenase, nitrate-inducible, iron-sulfur subunit (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01582: formate dehydrogenase, beta subunit
  • amino acids 5 to 285 (281 residues), 360.3 bits, E=3e-112
• PF12838: Fer4_7
  • amino acids 37 to 113 (77 residues), 31.6 bits, E=7.6e-11
• PF13247: Fer4_11
  • amino acids 91 to 188 (98 residues), 84 bits, E=3e-27
• PF12837: Fer4_6
  • amino acids 125 to 146 (22 residues), 29.9 bits, see alignment (E = 1.5e-10)
• PF12797: Fer4_2
  • amino acids 126 to 144 (19 residues), 28.4 bits, see alignment (E = 4.2e-10)
• PF00037: Fer4
  • amino acids 126 to 146 (21 residues), 33.5 bits, see alignment (E = 1e-11)
• PF13237: Fer4_10
  • amino acids 127 to 178 (52 residues), 25.2 bits, 5.5e-09
• PF09163: Form-deh_trans
  • amino acids 244 to 286 (43 residues), 59.3 bits, 1.1e-19

Best Hits

Swiss-Prot: 55% identical to FDNH_SHIFL: Formate dehydrogenase, nitrate-inducible, iron-sulfur subunit (fdnH) from Shigella flexneri

KEGG orthology group: K00124, formate dehydrogenase, beta subunit [EC: 1.2.1.2] (inferred from 100% identity to son:SO_0102)

MetaCyc: 55% identical to formate dehydrogenase N subunit beta (Escherichia coli K-12 substr. MG1655)
FORMATEDEHYDROG-RXN [EC: 1.17.5.3]

Predicted SEED Role

"Formate dehydrogenase N beta subunit (EC 1.2.1.2)" in subsystem Formate dehydrogenase or Formate hydrogenase (EC 1.2.1.2)

MetaCyc Pathways

• formate to dimethyl sulfoxide electron transfer (2/2 steps found)
• formate oxidation to CO₂ (1/1 steps found)
• formate to nitrite electron transfer (2/3 steps found)
• formate to trimethylamine N-oxide electron transfer (1/2 steps found)
• nitrate reduction III (dissimilatory) (1/2 steps found)
• oxalate degradation VI (1/4 steps found)
• oxalate degradation III (1/5 steps found)
• superpathway of C1 compounds oxidation to CO₂ (4/12 steps found)
• purine nucleobases degradation I (anaerobic) (5/15 steps found)
• purine nucleobases degradation II (anaerobic) (11/24 steps found)

KEGG Metabolic Maps

• Glyoxylate and dicarboxylate metabolism
• Methane metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.2.1.2

Use Curated BLAST to search for 1.17.5.3 or 1.2.1.2

Sequence Analysis Tools

See Q8EKJ0 at UniProt or InterPro

Protein Sequence (304 amino acids)

>SO0102 formate dehydrogenase, nitrate-inducible, iron-sulfur subunit (NCBI ptt file) (Shewanella oneidensis MR-1)
MATQDIIQRSGTSQATPPAQARVGGVKQIAKLFDATKCNGCKACQVACSEWNDLREEVGS
FQGTYQNPASLSPECWTLMKYNEIEDQGKLRWQFTHSACMHCADPACLKACSTSGAIIQH
ANGTVDFDSDKCIGCGYCASACPFDIPKISAVDNKAYKCTMCSDRLAVGLEPSCVKSCTT
GALRFGTREDMLFASEKRVNELKERGFPKAGLYNPEGVGGTGMLMILHDVTQPETYEMPK
DPQIPLSVTLWQDWVKPLGTVGLLATAAVACLHKITVGRNIVEEDQPGYQPPEEEVKQEE
EAKK