Protein Info for SO0102 in Shewanella oneidensis MR-1

Name: fdnH
Annotation: formate dehydrogenase, nitrate-inducible, iron-sulfur subunit (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 304 TIGR01582: formate dehydrogenase, beta subunit" amino acids 5 to 285 (281 residues), 360.3 bits, see alignment E=3e-112 PF12838: Fer4_7" amino acids 37 to 113 (77 residues), 32.3 bits, see alignment E=4.4e-11 PF13247: Fer4_11" amino acids 91 to 188 (98 residues), 84.4 bits, see alignment E=2.2e-27 PF13237: Fer4_10" amino acids 95 to 143 (49 residues), 26.5 bits, see alignment 2e-09 PF12837: Fer4_6" amino acids 125 to 146 (22 residues), 30 bits, see alignment (E = 1.4e-10) PF00037: Fer4" amino acids 126 to 146 (21 residues), 33.5 bits, see alignment (E = 1e-11) PF12797: Fer4_2" amino acids 127 to 144 (18 residues), 28.7 bits, see alignment (E = 3.5e-10) PF09163: Form-deh_trans" amino acids 244 to 287 (44 residues), 60.3 bits, see alignment 5.1e-20

Best Hits

Swiss-Prot: 55% identical to FDNH_SHIFL: Formate dehydrogenase, nitrate-inducible, iron-sulfur subunit (fdnH) from Shigella flexneri

KEGG orthology group: K00124, formate dehydrogenase, beta subunit [EC: 1.2.1.2] (inferred from 100% identity to son:SO_0102)

MetaCyc: 55% identical to formate dehydrogenase N subunit beta (Escherichia coli K-12 substr. MG1655)
FORMATEDEHYDROG-RXN [EC: 1.17.5.3]

Predicted SEED Role

"Formate dehydrogenase N beta subunit (EC 1.2.1.2)" in subsystem Formate dehydrogenase or Formate hydrogenase (EC 1.2.1.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.2.1.2

Use Curated BLAST to search for 1.17.5.3 or 1.2.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EKJ0 at UniProt or InterPro

Protein Sequence (304 amino acids)

>SO0102 formate dehydrogenase, nitrate-inducible, iron-sulfur subunit (NCBI ptt file) (Shewanella oneidensis MR-1)
MATQDIIQRSGTSQATPPAQARVGGVKQIAKLFDATKCNGCKACQVACSEWNDLREEVGS
FQGTYQNPASLSPECWTLMKYNEIEDQGKLRWQFTHSACMHCADPACLKACSTSGAIIQH
ANGTVDFDSDKCIGCGYCASACPFDIPKISAVDNKAYKCTMCSDRLAVGLEPSCVKSCTT
GALRFGTREDMLFASEKRVNELKERGFPKAGLYNPEGVGGTGMLMILHDVTQPETYEMPK
DPQIPLSVTLWQDWVKPLGTVGLLATAAVACLHKITVGRNIVEEDQPGYQPPEEEVKQEE
EAKK