Protein Info for SO0093 in Shewanella oneidensis MR-1

Annotation: NupC family protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 406 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details transmembrane" amino acids 31 to 55 (25 residues), see Phobius details amino acids 63 to 82 (20 residues), see Phobius details amino acids 88 to 111 (24 residues), see Phobius details amino acids 166 to 188 (23 residues), see Phobius details amino acids 194 to 214 (21 residues), see Phobius details amino acids 252 to 276 (25 residues), see Phobius details amino acids 285 to 306 (22 residues), see Phobius details amino acids 313 to 332 (20 residues), see Phobius details amino acids 344 to 369 (26 residues), see Phobius details amino acids 383 to 404 (22 residues), see Phobius details PF01773: Nucleos_tra2_N" amino acids 8 to 81 (74 residues), 80.1 bits, see alignment E=2.1e-26 PF07670: Gate" amino acids 91 to 187 (97 residues), 59.1 bits, see alignment E=8e-20 PF07662: Nucleos_tra2_C" amino acids 194 to 400 (207 residues), 234.1 bits, see alignment E=2.2e-73

Best Hits

Swiss-Prot: 47% identical to Y519_HAEIN: Uncharacterized transporter HI_0519 (HI_0519) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: None (inferred from 100% identity to son:SO_0093)

MetaCyc: 45% identical to putative nucleoside transporter (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EKJ9 at UniProt or InterPro

Protein Sequence (406 amino acids)

>SO0093 NupC family protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MSTIMSCIGIAVLVFIGYLFSENKRQIKFKTIAGALALQILLGAFVMFVPAGVTIIEAMS
SGVNSVIAFSNSGLTFVFGDLANYKLGFVFVINVLCVVIFISALISVLYYLKVMQFIINI
IGGGLSKVLGTSKAESLSATANIFVGPIEAPSMVRPLVKNMTRSELFAVMTGGLASVAGG
TMVGYINLGIDPKYILTACFMTAPAGLLFAKLLCPQTEHNLVNNDNKIEDADQPKGLLEA
ITDGSLMGMNQVITVTALLVSFVAIIALLNGIIGSIGNLFSIDKLTLEMIIGYLLSPLAF
LMGVPWSEAIPAASIIGQKIAINEFVAYISFLEVSNTLSDKTQAIVVFSLCGFANIGSLA
MVVGGIAAMCPDKRELITQIGPRVLLAAILANLMSGTIAGALVSLM