Protein Info for SO0065 in Shewanella oneidensis MR-1

Name: mog
Annotation: molybdenum cofactor biosynthesis protein Mog (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00177: molybdenum cofactor synthesis domain
  • amino acids 4 to 147 (144 residues), 137.5 bits, E=1.6e-44
• PF00994: MoCF_biosynth
  • amino acids 7 to 150 (144 residues), 99.3 bits, E=8.3e-33

Best Hits

Swiss-Prot: 66% identical to MOG_HELPY: Molybdopterin adenylyltransferase (mog) from Helicobacter pylori (strain ATCC 700392 / 26695)

KEGG orthology group: K03831, molybdopterin adenylyltransferase (inferred from 99% identity to sbm:Shew185_0065)

MetaCyc: 53% identical to molybdopterin adenylyltransferase (Escherichia coli K-12 substr. MG1655)
RXN-8344 [EC: 2.7.7.75]

Predicted SEED Role

"Molybdopterin biosynthesis molybdochelatase MogA"

MetaCyc Pathways

• molybdenum cofactor biosynthesis (2/3 steps found)
• bis(tungstenpterin) cofactor biosynthesis (1/4 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.75

Sequence Analysis Tools

See Q8EKM7 at UniProt or InterPro

Protein Sequence (177 amino acids)

>SO0065 molybdenum cofactor biosynthesis protein Mog (NCBI ptt file) (Shewanella oneidensis MR-1)
MSKAKIGIVTVSDRASAGIYEDISGKAIIDTLNDYLTSEWEPIYQVIPDEQDVIETTLIK
MADEQDCCLIVTTGGTGPAKRDVTPEATEAVCDRMMPGFGELMRAESLKFVPTAILSRQT
AGLRGDSLIVNLPGKPKSIRECLDAVFPAIPYCIDLMEGPYLECNEAVIKPFRPKAK