Protein Info for SO0045 in Shewanella oneidensis MR-1

Annotation: Rrf2 family protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00738: Rrf2 family protein
  • amino acids 1 to 130 (130 residues), 100.7 bits, E=3e-33
• PF02082: Rrf2
  • amino acids 3 to 131 (129 residues), 112 bits, E=1.2e-36

Best Hits

Swiss-Prot: 51% identical to NSRR_PHOPR: HTH-type transcriptional repressor NsrR (nsrR) from Photobacterium profundum (strain SS9)

KEGG orthology group: K13771, Rrf2 family transcriptional regulator, nitric oxide-sensitive transcriptional repressor (inferred from 100% identity to son:SO_0045)

Predicted SEED Role

"Nitrite-sensitive transcriptional repressor NsrR" in subsystem Nitrosative stress or Oxidative stress or Rrf2 family transcriptional regulators

Sequence Analysis Tools

See Q8EKP6 at UniProt or InterPro

Protein Sequence (151 amino acids)

>SO0045 Rrf2 family protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MQLTRYTDFGVRTLMYLAVQPDRTTLFRISEITEVFDLSPNHVSKIVHHLGKLGYLETIR
GKMGGFRLGKPAGEINLGQLIRSLENSLAPIDCSKPYCRFTPACQLKGVLAQAVEAYLNV
LDQYSLLDIVSNRNELLALLPDMSISVLQLD