Protein Info for SO0038 in Shewanella oneidensis MR-1

Name: hemF
Annotation: coproporphyrinogen III oxidase, aerobic (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 302 PF01218: Coprogen_oxidas" amino acids 9 to 301 (293 residues), 455.2 bits, see alignment E=3.3e-141

Best Hits

Swiss-Prot: 100% identical to HEM6_SHEON: Oxygen-dependent coproporphyrinogen-III oxidase (hemF) from Shewanella oneidensis (strain MR-1)

KEGG orthology group: K00228, coproporphyrinogen III oxidase [EC: 1.3.3.3] (inferred from 100% identity to son:SO_0038)

MetaCyc: 75% identical to coproporphyrinogen III oxidase (Escherichia coli K-12 substr. MG1655)
Coproporphyrinogen oxidase. [EC: 1.3.3.3]

Predicted SEED Role

"Coproporphyrinogen III oxidase, aerobic (EC 1.3.3.3)" in subsystem Experimental tye or Heme and Siroheme Biosynthesis (EC 1.3.3.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.3.3.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EKQ2 at UniProt or InterPro

Protein Sequence (302 amino acids)

>SO0038 coproporphyrinogen III oxidase, aerobic (NCBI ptt file) (Shewanella oneidensis MR-1)
MSLPDATVVKAFLLDLQHRICAGLEQLDGQASFAADSWTRAEGGGGTSRVLTQGAVFEQA
GVNFSHVTGAAMPASATAHRPELAGRSFEAMGVSLVIHPKNPYIPTTHANVRFFIAHKDG
AEPVWWFGGGFDLTPYYPFEEDVREWHQSAKNLCQPFGDDVYPKYKKWCDEYFFLPHRNE
TRGVGGLFFDDLNQAGFDKSFDFMQAVGNGFLTAYAPIVERRKDTDYGERERDFQLYRRG
RYVEFNLVYDRGTLFGLQTGGRTESILMSMPPLVRWQYAYTPAAGSPEADLYDNYLKPRD
WV