Protein Info for SO0030 in Shewanella oneidensis MR-1

Name: sun
Annotation: sun protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 428 PF01029: NusB" amino acids 1 to 124 (124 residues), 93.8 bits, see alignment E=3e-30 TIGR00563: 16S rRNA (cytosine(967)-C(5))-methyltransferase" amino acids 4 to 425 (422 residues), 454.6 bits, see alignment E=2.2e-140 PF22458: RsmF-B_ferredox" amino acids 141 to 211 (71 residues), 76.7 bits, see alignment E=3.1e-25 PF01189: Methyltr_RsmB-F" amino acids 233 to 423 (191 residues), 236.5 bits, see alignment E=5.4e-74 PF13847: Methyltransf_31" amino acids 241 to 375 (135 residues), 32.8 bits, see alignment E=1.3e-11

Best Hits

Swiss-Prot: 100% identical to RSMB_SHEON: Ribosomal RNA small subunit methyltransferase B (rsmB) from Shewanella oneidensis (strain MR-1)

KEGG orthology group: K03500, ribosomal RNA small subunit methyltransferase B [EC: 2.1.1.-] (inferred from 100% identity to son:SO_0030)

Predicted SEED Role

"16S rRNA (cytosine(967)-C(5))-methyltransferase (EC 2.1.1.176)" (EC 2.1.1.176)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.- or 2.1.1.176

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EKR0 at UniProt or InterPro

Protein Sequence (428 amino acids)

>SO0030 sun protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MNLRALAAKAIFDVLEKGVSLSVALPEQQKHLASGKDKALLAELCYGVMRTLPQIEKRTA
ECLAKPLKGKQRIIHQLLIVGCYQLYFTRIPSHAAISETAEACRQLKFEGMVKVVNGVLR
NIQRQLTPLSNESETLSYNTPGWLIKRLKTAYPGNWQEIIQQSHERPPMWLRNNRLSQSR
DEYLAALDKLEIDASAGLSDDAILLAAPKDVATLPLFLEGAASVQDGAAQWAATLLAPQA
NELILDACAAPGGKSCHLLELEPSIKLIAVDFDAKRLERVQQNLDRLSLKAEVIHGDAAN
IDSWWQGEQFDRILLDAPCSATGVIRRHPDIKWLRKNHDIEELAELQRQILDHCWKWLKP
GGTLLYATCSILPQENRDQISAFLARTADAKLDTLVQQASSQDIGWQITPGQHNMDGFYY
ARLLKATH