Protein Info for SO0010 in Shewanella oneidensis MR-1

Name: recF
Annotation: DNA replication and repair protein RecF (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 360 TIGR00611: DNA replication and repair protein RecF" amino acids 1 to 355 (355 residues), 347.5 bits, see alignment E=4.9e-108 PF13175: AAA_15" amino acids 1 to 72 (72 residues), 33.7 bits, see alignment E=9.5e-12 PF02463: SMC_N" amino acids 3 to 339 (337 residues), 123.6 bits, see alignment E=2.5e-39 PF13476: AAA_23" amino acids 5 to 102 (98 residues), 43.9 bits, see alignment E=1.4e-14 PF13514: AAA_27" amino acids 5 to 126 (122 residues), 24.9 bits, see alignment E=4.3e-09 PF13304: AAA_21" amino acids 25 to 67 (43 residues), 28.8 bits, see alignment 4e-10

Best Hits

Swiss-Prot: 100% identical to RECF_SHEON: DNA replication and repair protein RecF (recF) from Shewanella oneidensis (strain MR-1)

KEGG orthology group: K03629, DNA replication and repair protein RecF (inferred from 100% identity to son:SO_0010)

Predicted SEED Role

"DNA recombination and repair protein RecF" in subsystem DNA repair, bacterial RecFOR pathway

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EKT0 at UniProt or InterPro

Protein Sequence (360 amino acids)

>SO0010 DNA replication and repair protein RecF (NCBI ptt file) (Shewanella oneidensis MR-1)
MSLIRLNIDSFRNIQLAQLSPSEGINLIYGQNGSGKTSILEAIYFLGMGRSFRSHLSQRV
INNDQDKLTLFATLNLPRGDSKIGLRRFRSGETEVKIDGEKVKRLSTLAETLPIQVITPE
SFSLLFEGPKSRRQFIDWGAFHTDPQFYAAWMNVRRVLKQRNQMLRNGSPYDQIQYWDRE
FIRYTEQVTEIRNRYVDSLNELLKGIIGEFLPQVDVKVSFTRGWDSKTDFAQLLESQYPR
DLATGHTVSGPHKADLRLRVGTLPAQDALSRGQLKLLVCALRIAQGKLLKQQIDKHSIYL
VDDLPSELDAQHRQLLLKQLVDTGAQVFVTAIEPAAIVDSLHTPPSRMFHVEHGRVTVIE