Protein Info for Rru_A3785 in Rhodospirillum rubrum S1H

Annotation: 3' exoribonuclease (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 708 TIGR03591: polyribonucleotide nucleotidyltransferase" amino acids 12 to 692 (681 residues), 1065.8 bits, see alignment E=0 PF01138: RNase_PH" amino acids 15 to 145 (131 residues), 113.7 bits, see alignment E=2e-36 amino acids 324 to 456 (133 residues), 101.2 bits, see alignment E=1.5e-32 PF03725: RNase_PH_C" amino acids 148 to 212 (65 residues), 61.2 bits, see alignment E=1.9e-20 PF03726: PNPase" amino acids 244 to 320 (77 residues), 54 bits, see alignment E=4.9e-18 PF00013: KH_1" amino acids 556 to 613 (58 residues), 45.4 bits, see alignment 1.4e-15 PF00575: S1" amino acids 618 to 690 (73 residues), 63 bits, see alignment E=7.2e-21

Best Hits

Swiss-Prot: 100% identical to PNP_RHORT: Polyribonucleotide nucleotidyltransferase (pnp) from Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1)

KEGG orthology group: K00962, polyribonucleotide nucleotidyltransferase [EC: 2.7.7.8] (inferred from 100% identity to rru:Rru_A3785)

Predicted SEED Role

"Polyribonucleotide nucleotidyltransferase (EC 2.7.7.8)" in subsystem Bacterial RNA-metabolizing Zn-dependent hydrolases or Polyadenylation bacterial (EC 2.7.7.8)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RMR6 at UniProt or InterPro

Protein Sequence (708 amino acids)

>Rru_A3785 3' exoribonuclease (NCBI) (Rhodospirillum rubrum S1H)
MSLFNVFRKEIEWGGRKLVLETGRIARQADGAVMASLGDTTVLCTAVGAKTKSKFDFFPL
TVNYQEKTFAAGKIPGGFFKREGRPSEKETLVSRLIDRPIRPLFVHGYKNETQLVCTVLC
HDLENNPDIVAIVGASAALTLSGLPFLGPIGAARVGLIDGAFVLNPTRDQMADSVLDLVV
AGTREGVLMVESEAHELSEQQMLDAVMFGHEGYQPVIDAIIALAEQCAREPRAIEPPAPE
AEAVAAKVREVGEAGLRDAYKEADKMVRHDKVDAVRDAVTAAFAGDDAALALAGAAFKDL
EKDIVRGSILDTGLRIDGRDTKTVRPIEIYPGILPRAHGSALFTRGETQALVTTTLGTGQ
DEQIIDALEGEYRENFMLHYNFPPYSVGEAGRMGSPGRREIGHGKLAWRAIHPMMPAKDA
FPYTVRVVSEITESNGSSSMATVCGTSLALMDAGVPLKNAVAGIAMGLIKEDERFAVLSD
ILGDEDHLGDMDFKVAGTANGITSLQMDIKITSITKEIMNVALNQAKDGRIHILGEMTKA
LGNARSDVSDFAPRITTIKVPPQKVREVIGSGGKVIREITEVTGTKIDIEDDGTIKIASA
DAEATQRAVDWIKGIVAEPEIGVVYTGKVVKIMDFGAFVNFLGTRDGLVHISELSQDRVK
KVGDVVNVGDQVKVKCVGFDDRGKIKLSMKQVDQVTGADLSTQAPAEE