Protein Info for Rru_A3779 in Rhodospirillum rubrum S1H

Annotation: NusA antitermination factor (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 516 PF08529: NusA_N" amino acids 11 to 131 (121 residues), 129.1 bits, see alignment E=3.2e-41 TIGR01953: transcription termination factor NusA" amino acids 12 to 348 (337 residues), 443.9 bits, see alignment E=3.6e-137 PF00575: S1" amino acids 139 to 199 (61 residues), 24.2 bits, see alignment E=1.1e-08 PF13184: KH_NusA_1st" amino acids 205 to 282 (78 residues), 117.4 bits, see alignment E=7.6e-38 PF26594: KH_NusA_2nd" amino acids 286 to 351 (66 residues), 93.4 bits, see alignment E=1.8e-30 PF07650: KH_2" amino acids 292 to 343 (52 residues), 22.2 bits, see alignment 3e-08 TIGR01954: transcription termination factor NusA, C-terminal duplication" amino acids 371 to 418 (48 residues), 64.3 bits, see alignment 8e-22 PF14520: HHH_5" amino acids 371 to 415 (45 residues), 19.6 bits, see alignment 3.1e-07 amino acids 438 to 493 (56 residues), 19.9 bits, see alignment 2.5e-07

Best Hits

Swiss-Prot: 45% identical to NUSA_ECO57: Transcription termination/antitermination protein NusA (nusA) from Escherichia coli O157:H7

KEGG orthology group: K02600, N utilization substance protein A (inferred from 100% identity to rru:Rru_A3779)

Predicted SEED Role

"Transcription termination protein NusA" in subsystem NusA-TFII Cluster or Transcription factors bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RMS2 at UniProt or InterPro

Protein Sequence (516 amino acids)

>Rru_A3779 NusA antitermination factor (NCBI) (Rhodospirillum rubrum S1H)
MERTVGMSRPELVQVADTVARDKSIEREEVFAAMEQAIQKAGRSKYGHEHDIRARIDRKT
GEIRLARYIEVVEEVENEFTQITLAGAKRKKADIELGEFLVDPLPPIDFGRIAAQTAKQV
IVQKVRDAERERQFAEYKDRLGEIINGLVKRVEFGNVIVDMGRAEALLRRDEVIPREHFK
NGDRIRAYIMDVRQEPRGPQIFLSRTHEQFMAKLFAQEVPEIYDGIIEIKSVARDPGSRA
KIAVLSNDHAIDPVGACVGMRGSRVQAVVAELQGEKIDIIQWATDPATFVVNALAPAEVA
KVVLDEEANRIEVVVPDEQLSLAIGRRGQNVRLASKLTGWDIDILTEAEESERRQDEFRI
RTQAFIEALDVDDVIAHLLVTEGFTTVEDVAFVAIAELSEIEGFDEDVASELQNRAQVFL
AERERLNEERRKELGVVDEMAEIEGLTAAMLVALGEKGVKTLDDLGDLASDELIEIVGGL
NEDDANAVIMAARAHWFGEAGDSADDATAKTPEQDA