Protein Info for Rru_A3751 in Rhodospirillum rubrum S1H

Annotation: Argininosuccinate synthase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 419 TIGR00032: argininosuccinate synthase" amino acids 23 to 412 (390 residues), 493.5 bits, see alignment E=2.8e-152 PF00764: Arginosuc_synth" amino acids 23 to 184 (162 residues), 220.8 bits, see alignment E=1.1e-69 PF20979: Arginosuc_syn_C" amino acids 195 to 411 (217 residues), 279.5 bits, see alignment E=2e-87

Best Hits

Swiss-Prot: 100% identical to ASSY_RHORT: Argininosuccinate synthase (argG) from Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1)

KEGG orthology group: K01940, argininosuccinate synthase [EC: 6.3.4.5] (inferred from 100% identity to rru:Rru_A3751)

Predicted SEED Role

"Argininosuccinate synthase (EC 6.3.4.5)" in subsystem Arginine Biosynthesis extended (EC 6.3.4.5)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.4.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RMV0 at UniProt or InterPro

Protein Sequence (419 amino acids)

>Rru_A3751 Argininosuccinate synthase (NCBI) (Rhodospirillum rubrum S1H)
MGSGCIPPMVKKALSMKKGDVKKVVLAYSGGLDTSIILRWLQDEYDCEVVTFTADIGQGE
ELEPARQKAEMMGIKEIYIEDLREEFVRDYVFPMFRANTLYEGVYLLGTSIARPLIGKRL
VEIAEATGADAVSHGATGKGNDQVRFELTAYALKPDIKIIAPWRTWDLHSRTKLIEYAMR
HQIPVPKDKHGEAPYSMDANLLHISYEGKALENPWTEPSEDMFRLTVSPEAAPDKAQYIE
VDFERGDAVAIDGEKLTPAALLAKLNEIGGRHGVGRLDLVENRYVGMKSRGVYETPGGTI
LQVAHRAVESLTLDREVMHLRDELMPRYAKLIYNGFWFAPERLMLQAAIDQTQQTVTGTA
RLKLYKGNVSVVGRKAAKSLYRMDYVTFEEDTVYDQHDAEGFIKLNALRLRLGKMARDS