Protein Info for Rru_A3740 in Rhodospirillum rubrum S1H

Annotation: Shikimate kinase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13671: AAA_33
  • amino acids 16 to 128 (113 residues), 28.9 bits, E=1.9e-10
• PF01202: SKI
  • amino acids 21 to 172 (152 residues), 156.3 bits, E=1.1e-49

Best Hits

Swiss-Prot: 100% identical to AROK_RHORT: Shikimate kinase (aroK) from Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1)

KEGG orthology group: K00891, shikimate kinase [EC: 2.7.1.71] (inferred from 100% identity to rru:Rru_A3740)

Predicted SEED Role

"Shikimate kinase I (EC 2.7.1.71)" in subsystem Benzoate transport and degradation cluster or Chorismate Synthesis or Common Pathway For Synthesis of Aromatic Compounds (DAHP synthase to chorismate) (EC 2.7.1.71)

MetaCyc Pathways

• superpathway of aromatic amino acid biosynthesis (18/18 steps found)
• superpathway of L-tryptophan biosynthesis (13/13 steps found)
• superpathway of L-phenylalanine biosynthesis (10/10 steps found)
• superpathway of L-tyrosine biosynthesis (10/10 steps found)
• chorismate biosynthesis I (7/7 steps found)
• chorismate biosynthesis from 3-dehydroquinate (5/5 steps found)
• chorismate biosynthesis II (archaea) (8/12 steps found)
• superpathway of chorismate metabolism (37/59 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Phenylalanine, tyrosine and tryptophan biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.71

Sequence Analysis Tools

See Q2RMW1 at UniProt or InterPro

Protein Sequence (188 amino acids)

>Rru_A3740 Shikimate kinase (NCBI) (Rhodospirillum rubrum S1H)
MIEAEENTLALPRTLVLVGLMGAGKTCIGRRLAQMAGVPFVDADVEIERAAKRTIAEIFA
TYGESEFRALERRVMARLLAGRTCVLATGGGAFMAEDTRALIRLHGLSLWLRADLDLLVA
RTAGRTHRPLLNNGDAREKLAELMAKRHPVYAEADIVFDALDESQDASALRVRSCLLSYL
ADHAETAP