Protein Info for Rru_A3718 in Rhodospirillum rubrum S1H

Annotation: hypothetical protein (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 462 transmembrane" amino acids 55 to 73 (19 residues), see Phobius details amino acids 79 to 97 (19 residues), see Phobius details amino acids 105 to 126 (22 residues), see Phobius details amino acids 138 to 155 (18 residues), see Phobius details amino acids 167 to 185 (19 residues), see Phobius details amino acids 205 to 224 (20 residues), see Phobius details amino acids 234 to 252 (19 residues), see Phobius details amino acids 258 to 273 (16 residues), see Phobius details amino acids 280 to 300 (21 residues), see Phobius details amino acids 328 to 347 (20 residues), see Phobius details amino acids 368 to 391 (24 residues), see Phobius details amino acids 427 to 448 (22 residues), see Phobius details

Best Hits

KEGG orthology group: None (inferred from 100% identity to rru:Rru_A3718)

Predicted SEED Role

"FIG01011124: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RMY3 at UniProt or InterPro

Protein Sequence (462 amino acids)

>Rru_A3718 hypothetical protein (NCBI) (Rhodospirillum rubrum S1H)
MSGGRGRVLALKAGGGRIRPLAGTDAPPLPRPMVGDGVEAAGGVGEVFGSLHWKTVLVFV
SLPMVLQVFHYMIDVGPVYYLSKIWPLALLPLGLKVFREFSGEKVIYGFAIVYLTGVTPI
MSMIHFDNNVVDALATTVKVWPLTYFFSFLGLLWIARPQEDRLRAQVLGLGLATLAVMWL
MWIFIPKSFYSSQIGMTKLFLWDELRSYHIYFPMTFSLILLFYSVRRFLSTHRAWIWMLP
ALFGLLTMAVILKQRTTIAAALVVVGLIVLRRLPRPMLIGAVALGGALAVLGGVIVLLAP
PGGPADAITSLFDFGGSLSVRQQTAAKAAGVIFASPLSWILGSGAITRLSPVTLNDIFAS
KMFFLADIGWLGVLFEYGAIGSILIALVYAIGLRRALRSGIAPPGSPAGDFRGALGDMIV
MVSVETLIYSPVFTPGIVAGLTAFLIYLDKGVPARGGGMQRG