Protein Info for Rru_A3717 in Rhodospirillum rubrum S1H

Annotation: Glycosyl transferase WecB/TagA/CpsF (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 261 transmembrane" amino acids 191 to 207 (17 residues), see Phobius details PF03808: Glyco_tran_WecG" amino acids 71 to 237 (167 residues), 100.9 bits, see alignment E=3.6e-33

Best Hits

KEGG orthology group: None (inferred from 100% identity to rru:Rru_A3717)

Predicted SEED Role

"Glycosyl transferase WecB/TagA/CpsF"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RMY4 at UniProt or InterPro

Protein Sequence (261 amino acids)

>Rru_A3717 Glycosyl transferase WecB/TagA/CpsF (NCBI) (Rhodospirillum rubrum S1H)
MTTADTRTGDLPPGVSYLGIAYSGLTLEQAAAALAARPAGAAFAYVVTPNAQHVVHLNRG
EPFFTLAYRDAWLRLSDSRVLAALTKLIGGPRLPVATGSDLTALLFQSVITADDPLVVIG
GTAETDERLRAMFGLRHLVSHRPPMGVLRNPQAIAACVEFIAAHPARFVFFAVGSPQSEV
IAQHAFASGRATGSGLCIGGALLFLTGQVKRAPLWMRRLALEWLYRLLANPRGHFRRVFV
DSLPLVGLVLADRFKTRRSAK