Protein Info for Rru_A3677 in Rhodospirillum rubrum S1H

Annotation: Tripartite ATP-independent periplasmic transporter, DctQ component (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 241 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 44 to 63 (20 residues), see Phobius details amino acids 92 to 116 (25 residues), see Phobius details amino acids 150 to 172 (23 residues), see Phobius details PF04290: DctQ" amino acids 20 to 175 (156 residues), 70.4 bits, see alignment E=7.4e-24

Best Hits

KEGG orthology group: K11689, C4-dicarboxylate transporter, DctQ subunit (inferred from 100% identity to rru:Rru_A3677)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RN24 at UniProt or InterPro

Protein Sequence (241 amino acids)

>Rru_A3677 Tripartite ATP-independent periplasmic transporter, DctQ component (NCBI) (Rhodospirillum rubrum S1H)
MKVLDHLEEALIAFLMAAATLIIFVAVVHRYASGVAFLYPYVGHLHFAWAQELCIILFVW
MAKFGAAYGVRTGIHVGVDVVINRLKPRARGVFIVFGLLAGAAFTGCVAVLGGSFVWDNG
AHYAFVTALGLEIGDLYEGPITADLEWPTWIVYSAIPLGSSLMCFRFLQVCVGFLRTGEL
PHHDHGHVEGLDEDKTDAQRAAQDINWFTMNDGLHPKDIAHDDDTGDKPDDGTGTGKGDG
R