Protein Info for Rru_A3676 in Rhodospirillum rubrum S1H

Annotation: TRAP dicarboxylate transporter, DctM subunit (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 427 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details transmembrane" amino acids 55 to 74 (20 residues), see Phobius details amino acids 86 to 107 (22 residues), see Phobius details amino acids 112 to 128 (17 residues), see Phobius details amino acids 138 to 161 (24 residues), see Phobius details amino acids 168 to 193 (26 residues), see Phobius details amino acids 214 to 234 (21 residues), see Phobius details amino acids 240 to 256 (17 residues), see Phobius details amino acids 268 to 292 (25 residues), see Phobius details amino acids 307 to 327 (21 residues), see Phobius details amino acids 335 to 352 (18 residues), see Phobius details amino acids 357 to 380 (24 residues), see Phobius details amino acids 392 to 416 (25 residues), see Phobius details PF06808: DctM" amino acids 8 to 415 (408 residues), 438.4 bits, see alignment E=1.3e-135 TIGR00786: TRAP transporter, DctM subunit" amino acids 17 to 421 (405 residues), 509.4 bits, see alignment E=3.1e-157

Best Hits

Swiss-Prot: 78% identical to DCTM_RHOCA: C4-dicarboxylate TRAP transporter large permease protein DctM (dctM) from Rhodobacter capsulatus

KEGG orthology group: K11690, C4-dicarboxylate transporter, DctM subunit (inferred from 100% identity to rru:Rru_A3676)

Predicted SEED Role

"TRAP-type C4-dicarboxylate transport system, large permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RN25 at UniProt or InterPro

Protein Sequence (427 amino acids)

>Rru_A3676 TRAP dicarboxylate transporter, DctM subunit (NCBI) (Rhodospirillum rubrum S1H)
MSALIIFTLLLCLMLTGMPISISLGLTVLTFLFTMTTVPIESVALKLFTGIEKFEIMAIP
FFILAGNFLTHGGVAKRMINFATAMVGHWYGGLGLGGVVACALFAAISGSSPATVVAIGS
ILLPAMVKQGFPRRFGAGVITTSGALGILIPPSLVMVMYAVATNTSVGALFMAGVVPGLV
LATLLGVTTSVIARKNNYPRLPKASWATRAKAFREAIWGLMLVVIVIGGIYSGIFTPTEA
AAMSAVYAFLIAVFVYKDMPLRGVVKILLSSASMSAMLLYIITNAVLFSFVLANENIPQA
IADWIVGKELGIVAFLLVVNVLLLAAGNFMEPSSIVLIMAPILFPVAMKLGIDPVHFGIL
IIVNMEVGMCHPPVGLNLYVASGITKMGISELTVAVMPWLLTMLGFLIVVTYWPGLSLWL
PRALGMM