Protein Info for Rru_A3673 in Rhodospirillum rubrum S1H

Annotation: Glutaconyl-CoA decarboxylase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 376 transmembrane" amino acids 20 to 40 (21 residues), see Phobius details amino acids 47 to 64 (18 residues), see Phobius details amino acids 75 to 96 (22 residues), see Phobius details amino acids 108 to 129 (22 residues), see Phobius details amino acids 167 to 188 (22 residues), see Phobius details amino acids 209 to 236 (28 residues), see Phobius details amino acids 256 to 274 (19 residues), see Phobius details amino acids 285 to 307 (23 residues), see Phobius details amino acids 318 to 336 (19 residues), see Phobius details amino acids 352 to 375 (24 residues), see Phobius details TIGR01109: sodium ion-translocating decarboxylase, beta subunit" amino acids 24 to 368 (345 residues), 436.6 bits, see alignment E=3.4e-135 PF03977: OAD_beta" amino acids 25 to 372 (348 residues), 480.4 bits, see alignment E=1.6e-148

Best Hits

Swiss-Prot: 56% identical to GCDB_ACIFV: Glutaconyl-CoA decarboxylase subunit beta (gcdB) from Acidaminococcus fermentans (strain ATCC 25085 / DSM 20731 / VR4)

KEGG orthology group: None (inferred from 100% identity to rru:Rru_A3673)

MetaCyc: 56% identical to GcdB (Acidaminococcus fermentans)
RXN-19739 [EC: 7.2.4.5]

Predicted SEED Role

No annotation

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.2.4.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RN28 at UniProt or InterPro

Protein Sequence (376 amino acids)

>Rru_A3673 Glutaconyl-CoA decarboxylase (NCBI) (Rhodospirillum rubrum S1H)
MLDQLIAFAQALESQTGLSHFWWGNAVMIAIGATMIYLAVSKKYEPLLLVGIGFSCIIAN
VPGSDLILPGGLFNYAYQGVALLIIPPLIFFGVGAMTDFGPMIANPKLVILGAAAHLGIF
VALILAKLLGFTLAEAGAIGIIGGADGPMAIFVTMKLAPHLLPQVSVAAYSYMALMPLIQ
PPVMRLLTTRKERLITMRQSRPVSRLEKIAFPIVIGIVVNLFLPPVAPLITMLMLGNLFR
EVLVVDRLVKTAANDLMNVIIIILTVAIGSTMNADSFLTIQTVQIVVLGLVAFIFGTASG
VIGAKIMNLFLKEKINPLLGSAGIASVPIAARVSHIVALRENPTNYLIYHAMGPNLAGVF
GTAISGGIMLALIGVK