Protein Info for Rru_A3671 in Rhodospirillum rubrum S1H

Annotation: SecD export membrane protein (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 853 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details transmembrane" amino acids 362 to 381 (20 residues), see Phobius details amino acids 387 to 407 (21 residues), see Phobius details amino acids 413 to 433 (21 residues), see Phobius details amino acids 459 to 481 (23 residues), see Phobius details amino acids 487 to 514 (28 residues), see Phobius details amino acids 544 to 563 (20 residues), see Phobius details amino acids 666 to 683 (18 residues), see Phobius details amino acids 690 to 711 (22 residues), see Phobius details amino acids 715 to 736 (22 residues), see Phobius details amino acids 765 to 787 (23 residues), see Phobius details amino acids 793 to 819 (27 residues), see Phobius details PF07549: Sec_GG" amino acids 36 to 62 (27 residues), 25.8 bits, see alignment (E = 1.1e-09) amino acids 559 to 586 (28 residues), 34 bits, see alignment (E = 2.9e-12) TIGR01129: protein-export membrane protein SecD" amino acids 44 to 510 (467 residues), 484.6 bits, see alignment E=3.9e-149 PF21760: SecD_1st" amino acids 155 to 211 (57 residues), 91.7 bits, see alignment 3.1e-30 TIGR00916: protein-export membrane protein, SecD/SecF family" amino acids 273 to 503 (231 residues), 271.7 bits, see alignment E=7.7e-85 amino acids 630 to 809 (180 residues), 165.6 bits, see alignment E=2.1e-52 PF02355: SecD_SecF" amino acids 345 to 512 (168 residues), 68.3 bits, see alignment E=1.3e-22 amino acids 645 to 821 (177 residues), 212.8 bits, see alignment E=6.2e-67 PF03176: MMPL" amino acids 392 to 516 (125 residues), 35.1 bits, see alignment E=1.5e-12 TIGR00966: protein-export membrane protein SecF" amino acids 565 to 812 (248 residues), 249.2 bits, see alignment E=7.9e-78

Best Hits

KEGG orthology group: K12257, SecD/SecF fusion protein (inferred from 100% identity to rru:Rru_A3671)

Predicted SEED Role

"Protein-export membrane protein SecD (TC 3.A.5.1.1) / Protein-export membrane protein SecF (TC 3.A.5.1.1)" (TC 3.A.5.1.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RN30 at UniProt or InterPro

Protein Sequence (853 amino acids)

>Rru_A3671 SecD export membrane protein (NCBI) (Rhodospirillum rubrum S1H)
MLYFSKAKTIAIIAVCLIGLLLALPNAFKHGSLPDWLPQNRITLGLDLQGGSHLLLAVDM
PAVIHDRLETMLESVRTNLRKDSLRYTGLAVRDRSVVFTLASADDIETARGALAPLVQPD
EPGKPADYGLTFDGLTGRIALADSGVQAWADKAAQQSIEIVRRRIDETGVNEPMIARQGA
DRILVQLPGVSDPGRIKRLLGQTAKMTFHMVGDRALGDGSVPAGYRLLPSADPARPGEKI
LVSRKVEVDGSHLTDAKPSFDQQNGQWVVSFSFDGQGARRFADVTKMAVGKPFAIVLDDK
VVSAPVIREPITGGRGQISGSFTAASANDLAVLLRAGALPAPLTVVEERTVGPDLGADSI
RAGMIAISVGFVLVVAYMGIFYGLFGWFANVALVFNLAITLGALSLMQATLTLPGIAGLL
LSLGMAVDANILINERIREEAKKGRGVAASMETGFKRAFATIFDSNITTLIKMAILFSIG
VGTIRGFAVTISLGIIVSMFTAITVTRLLMVIWFRRTKPKSLPMANHFRLVPDHTKIAFM
RGRLLGLGGSVVLSVASVVLFFHPGLNYGVDFAGGTVMEVRSQNAVDFPALRTDLQSLPI
GPVQLQAFGSPNDVLIRLERQEGGDAAQAEVVKQVQGMLERDYAGSEIRRVDSVGASVSA
ELFQDGMMALGLAAIAMLIYIWFRFEWQFGVGAVVTMLLDVTKTVGFFAITGMQFNLTAI
AAILTIMGYSINDKVVVYDRVRENLRLYRTMPLRQLIDKSINETLGRTVGTSLATFLAII
PLAVFGGEALREFALVLLFGVVLATSSSVFIAAPLLLLLGEHRLRPGLSAKALAKTEGET
ETDDTGEAPTPAR