Protein Info for Rru_A3669 in Rhodospirillum rubrum S1H

Annotation: Uncharacterized protein UPF0114 (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 166 transmembrane" amino acids 20 to 39 (20 residues), see Phobius details amino acids 57 to 78 (22 residues), see Phobius details amino acids 109 to 127 (19 residues), see Phobius details amino acids 137 to 157 (21 residues), see Phobius details TIGR00645: TIGR00645 family protein" amino acids 5 to 163 (159 residues), 165.2 bits, see alignment E=8e-53 PF03350: UPF0114" amino acids 12 to 126 (115 residues), 98.5 bits, see alignment E=1.6e-32

Best Hits

Swiss-Prot: 51% identical to Y780_SHEB5: UPF0114 protein Sbal_0780 (Sbal_0780) from Shewanella baltica (strain OS155 / ATCC BAA-1091)

KEGG orthology group: None (inferred from 100% identity to rru:Rru_A3669)

Predicted SEED Role

"Putative inner membrane protein (Fragment)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RN32 at UniProt or InterPro

Protein Sequence (166 amino acids)

>Rru_A3669 Uncharacterized protein UPF0114 (NCBI) (Rhodospirillum rubrum S1H)
MKPLELLIERIILASRWMLVIFYLGLGAALAVYAVSFLYKFAKIAGDVFVLGEAEMILAM
LSLIDAALVASLIVMVMISSYENFVGRFDDHQVEVSWLGKLDAGSLKIKVASSIVAISSI
HLLQIFLNASQYDNGKIMWFTLMHLTFVVSALMLGFLEKILHKEKI