Protein Info for Rru_A3656 in Rhodospirillum rubrum S1H

Annotation: Polysaccharide biosynthesis protein CapD (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 652 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 52 to 70 (19 residues), see Phobius details amino acids 82 to 102 (21 residues), see Phobius details amino acids 113 to 131 (19 residues), see Phobius details amino acids 152 to 165 (14 residues), see Phobius details PF04321: RmlD_sub_bind" amino acids 296 to 547 (252 residues), 56.8 bits, see alignment E=4.9e-19 PF02719: Polysacc_synt_2" amino acids 297 to 587 (291 residues), 372.3 bits, see alignment E=4.2e-115 PF01370: Epimerase" amino acids 297 to 513 (217 residues), 80.7 bits, see alignment E=2.8e-26 PF01073: 3Beta_HSD" amino acids 298 to 428 (131 residues), 42.6 bits, see alignment E=1e-14 PF16363: GDP_Man_Dehyd" amino acids 298 to 421 (124 residues), 48.2 bits, see alignment E=2.9e-16

Best Hits

KEGG orthology group: K13013, O-antigen biosynthesis protein WbqV (inferred from 100% identity to rru:Rru_A3656)

Predicted SEED Role

"Nucleoside-diphosphate sugar epimerase/dehydratase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RN45 at UniProt or InterPro

Protein Sequence (652 amino acids)

>Rru_A3656 Polysaccharide biosynthesis protein CapD (NCBI) (Rhodospirillum rubrum S1H)
MRSLFTPMPPRARIVFAHDVVMAALSFVISLYLRLGDGLIRYVPLPDLGREAALFAACAA
VAFYTQRMYVGIWRYASVDDLIALLRGATLTLVLFLPAAFLITRMEYVPRSVLVINWVVL
MALLGGPRFLYRLFKDRKFQLRRARSRSAIPVLLVGAGDGCEMFLRSVARETDSPYLPVG
ILSEQETRVGRNLRGVEVLGTLDRLAEIVVRLERWGERPRKLILTSETLDPAQVRGLLDA
CDALGLSLARLPRLMELRDGGADSLEVRPVAIEDLLGRPQAVLDRAPVVALVGGRRVLVT
GAGGSIGSELVRQIAALDPARLILADSSEFALYTIDMEINERYPTLSRRPVIADVRDGDR
VDRVMAEEKPELVFHAAALKHVPMVEFNPLEGLRTNALGTRTVAEACRRHGVGTMVLIST
DKAVNPTNVMGASKRMAESWCQALDLAERTSAAATHFVTVRFGNVLGSTGSVVPLFQRQL
AAGGPLTVTHPEITRFFMTIREAVELVLQAAALGSREESYRGSLFVLDMGEPVKIADLAR
QMIRLAGLKPEVDVQIAYTGLRPGEKLFEEIFHGKETSLPTPTDGVLVAAPRVPDPVFLG
IQFDALARACAAGDEAQARAVIAALVPEFHNPPAETTPQPFEGECAQARAVL