Protein Info for Rru_A3627 in Rhodospirillum rubrum S1H

Annotation: Cobyrinic acid a,c-diamide synthase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 276 PF13614: AAA_31" amino acids 21 to 196 (176 residues), 206.1 bits, see alignment E=1.6e-64 PF10609: ParA" amino acids 21 to 187 (167 residues), 50.2 bits, see alignment E=9.4e-17 PF09140: MipZ" amino acids 22 to 174 (153 residues), 43.8 bits, see alignment E=8e-15 PF06564: CBP_BcsQ" amino acids 22 to 168 (147 residues), 37.8 bits, see alignment E=6.5e-13 PF00142: Fer4_NifH" amino acids 23 to 74 (52 residues), 33 bits, see alignment 1.8e-11 PF01656: CbiA" amino acids 23 to 247 (225 residues), 112.1 bits, see alignment E=7.2e-36 PF02374: ArsA_ATPase" amino acids 28 to 64 (37 residues), 29.3 bits, see alignment 2.1e-10

Best Hits

Swiss-Prot: 66% identical to PARA_CAUVC: Chromosome partitioning protein ParA (parA) from Caulobacter vibrioides (strain ATCC 19089 / CB15)

KEGG orthology group: K03496, chromosome partitioning protein (inferred from 100% identity to rru:Rru_A3627)

Predicted SEED Role

"Chromosome (plasmid) partitioning protein ParA" in subsystem Bacterial Cytoskeleton or Plasmid replication or Two cell division clusters relating to chromosome partitioning

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RN74 at UniProt or InterPro

Protein Sequence (276 amino acids)

>Rru_A3627 Cobyrinic acid a,c-diamide synthase (NCBI) (Rhodospirillum rubrum S1H)
MPDQAIAAPALSAKLVLNTPRIIAIANQKGGVGKTTTAINLATALAATGKRVLIIDMDPQ
GNASTGLGLSSAARKVTTYDILMGDAKARAAVTPTGIPRLAVIPAGVDLAGAELELVERT
QREFRLRMALADELIDFDYVLVDCPPALGLLTLNALIAADAVMVPLQCEFFALEGVSHLV
KTIDRVRKAFNPRLEIQGIVLTMFDRRNNLSEMVAADVRDYFGAKVYKTVIPRNVRISEA
PSHGKPVLLYDLKCAGSQAYLHLAGEIIKQEGGLAA