Protein Info for Rru_A3625 in Rhodospirillum rubrum S1H

Annotation: Glucose-inhibited division protein A subfamily (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 629 PF01134: GIDA" amino acids 6 to 393 (388 residues), 546.2 bits, see alignment E=9.5e-168 TIGR00136: tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA" amino acids 6 to 619 (614 residues), 785.8 bits, see alignment E=1.4e-240 PF12831: FAD_oxidored" amino acids 6 to 36 (31 residues), 29.1 bits, see alignment (E = 1.3e-10) PF21680: GIDA_C_1st" amino acids 462 to 552 (91 residues), 56.6 bits, see alignment E=7.1e-19 PF13932: SAM_GIDA_C" amino acids 558 to 613 (56 residues), 72.5 bits, see alignment 3.9e-24

Best Hits

Swiss-Prot: 100% identical to MNMG_RHORT: tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG (mnmG) from Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1)

KEGG orthology group: K03495, glucose inhibited division protein A (inferred from 100% identity to rru:Rru_A3625)

Predicted SEED Role

"tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RN76 at UniProt or InterPro

Protein Sequence (629 amino acids)

>Rru_A3625 Glucose-inhibited division protein A subfamily (NCBI) (Rhodospirillum rubrum S1H)
MTNHWDVIVVGGGHAGTEAAAAAARLGAKTLLATHKLETVGTMSCNPAIGGLAKGHLVRE
IDALDGVMGRAIDRGGIQFRILNRSKGPAVRGPRAQADRALYAQAVRAILADQPGLTLAA
LAIEDLLIGNDGRCAGVIDAEGGVHRAGAVVLTTGTFLRGVIHIGTQTTPAGRIGEAPAL
GLSATLARLGFPLGRLKTGTPPRLDGRTIAWATLESQPGDEPPPPFSFLTTAITTPQISC
AITETTAETHRVIRENLHRAPLYSGQIQGVGPRYCPSIEDKVVRFADRDRHQIFLEPEGL
DDPTVYPNGISTSLPIDVQLALLATIPGLEKAEMMRPGYAIEYDFVDPRCLGPTLETDRL
PGLFLAGQINGTTGYEEAAAQGLIAGLNAARVAGAGERAAPITFDRAEGYLGVLVDDLIT
LGTTEPYRMFTSRAEYRLLLRADNADLRLTAKGIALGCVGAARTAAFEDKRAALTAARTM
IDGLALTPPDLARRGIAVNQDGQRRTPLDLLCHADIDWARLVALWPELGAIRPDVAEQLE
IGARYAGYLERMHGDVAAFRRDEALVLPADLAYDGLANLSAELRGKLTLARPATLGAAAR
IPGMTPAALTALLRHVKRRERDSVEECFT