Protein Info for Rru_A3606 in Rhodospirillum rubrum S1H

Annotation: Protein of unknown function DUF224, cysteine-rich region (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02754: CCG
  • amino acids 12 to 93 (82 residues), 52.3 bits, E=2.7e-18
  • amino acids 141 to 225 (85 residues), 52.7 bits, E=1.9e-18

Best Hits

Swiss-Prot: 48% identical to LUTA_EXISA: Lactate utilization protein A (lutA) from Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b)

KEGG orthology group: None (inferred from 100% identity to rru:Rru_A3606)

MetaCyc: 45% identical to iron-sulfur oxidase subunit used in L-lactate utilization (Bacillus subtilis subtilis 168)
L-lactate dehydrogenase. [EC: 1.1.1.27]

Predicted SEED Role

"Predicted L-lactate dehydrogenase, Fe-S oxidoreductase subunit YkgE" in subsystem Lactate utilization

MetaCyc Pathways

• homolactic fermentation (11/12 steps found)
• Bifidobacterium shunt (13/15 steps found)
• superpathway of anaerobic sucrose degradation (15/19 steps found)
• pyruvate fermentation to acetate and (S)-lactate I (4/4 steps found)
• pyruvate fermentation to acetate and lactate II (4/4 steps found)
• (S)-lactate fermentation to propanoate, acetate and hydrogen (10/13 steps found)
• hexitol fermentation to lactate, formate, ethanol and acetate (14/19 steps found)
• pyruvate fermentation to (S)-lactate (1/1 steps found)
• superpathway of glucose and xylose degradation (12/17 steps found)
• heterolactic fermentation (11/18 steps found)

KEGG Metabolic Maps

• Cysteine metabolism
• Glycolysis / Gluconeogenesis
• Propanoate metabolism
• Pyruvate metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.27

Sequence Analysis Tools

See Q2RN95 at UniProt or InterPro

Protein Sequence (270 amino acids)

>Rru_A3606 Protein of unknown function DUF224, cysteine-rich region (NCBI) (Rhodospirillum rubrum S1H)
MTDDSPLGGPRVGFFITCMTDLFRPTVGFAAIRLLTRAGCRVEVPADQTCCGQPAFNSGA
RDLAITQAKRVIETFEGFDYLVGPSGSCLGMIRVHYPALLAEDAAWAGRARALAERSFEV
MSFLTDVLDWDDIDARFDGVVTYHDTCSGVREVGIKAQPRRLLAKVRGLELRELAAPEEC
CGFGGTFCVKYPEISGRMVDEKLRDAEATGATTLLGGDTSCLLNIAGRARQIGSPLAVRH
ALEVLAGMAEGPGLGDGAETPPSPRVPHPV