Protein Info for Rru_A3605 in Rhodospirillum rubrum S1H

Annotation: Iron-sulfur cluster binding protein (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 472 TIGR00273: iron-sulfur cluster-binding protein" amino acids 18 to 455 (438 residues), 460.5 bits, see alignment E=2.8e-142 PF02589: LUD_dom" amino acids 68 to 296 (229 residues), 162.5 bits, see alignment E=3.1e-51 PF13183: Fer4_8" amino acids 310 to 378 (69 residues), 46.5 bits, see alignment E=1.4e-15 PF13534: Fer4_17" amino acids 313 to 378 (66 residues), 31.3 bits, see alignment E=7.4e-11 PF11870: LutB_C" amino acids 402 to 468 (67 residues), 31.7 bits, see alignment E=5.1e-11

Best Hits

Swiss-Prot: 41% identical to LUTB_BACLD: Lactate utilization protein B (lutB) from Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46)

KEGG orthology group: None (inferred from 100% identity to rru:Rru_A3605)

Predicted SEED Role

"Predicted L-lactate dehydrogenase, Iron-sulfur cluster-binding subunit YkgF" in subsystem L-rhamnose utilization or Lactate utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RN96 at UniProt or InterPro

Protein Sequence (472 amino acids)

>Rru_A3605 Iron-sulfur cluster binding protein (NCBI) (Rhodospirillum rubrum S1H)
MDPKSRAFKDNARKALTDDTLASALGTMKAGFRRARAEAIGRLPEFDALRDAGRDLKNHV
LDNLDFYLETFEAKVIAQGGHVHWCRDAAEARETILAICRDSGAKTVTKGKSMITEEIGL
NAYLEANGVTPIETDLGEYIIQLRGETPSHIVAPAIHLRRPHVAEAFRKAHTQFAADRRL
EEHRDFLDEARAVMRGNFLAADVGITGANMMIAETGSTVIVTNEGNGDLTQLLPRVHVVV
ASLEKIVPTLDDAALVLRLLARSASGQDMSAYTTFSTGPRRPDDVDGPDAFHVVLLDNGR
SDMLGTGFQEMLRCIRCAACMNHCPVYGAIGGHAYGWVYPGPMGSVLTPALIGLEQAADL
PNASTLCGRCEEVCPMRIPLPRMLRHWREKEFERHLTPKPARFGLGAWAFVAARPGLYRL
TTRLIAGALSRLGGKRGHLRSLGLANGWTAVRAMPAPEGRTFMDRWRQGERP