Protein Info for Rru_A3599 in Rhodospirillum rubrum S1H

Annotation: 20S proteasome, A and B subunits (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 187 PF00227: Proteasome" amino acids 16 to 186 (171 residues), 83.6 bits, see alignment E=7.3e-28 TIGR03692: ATP-dependent protease HslVU, peptidase subunit" amino acids 18 to 186 (169 residues), 275 bits, see alignment E=1e-86

Best Hits

Swiss-Prot: 79% identical to HSLV_OLICO: ATP-dependent protease subunit HslV (hslV) from Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / KCTC 32145 / OM5)

KEGG orthology group: K01419, ATP-dependent HslUV protease, peptidase subunit HslV [EC: 3.4.25.2] (inferred from 100% identity to rru:Rru_A3599)

MetaCyc: 65% identical to peptidase component of the HslVU protease (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"ATP-dependent protease HslV (EC 3.4.25.-)" in subsystem Proteasome bacterial or Proteolysis in bacteria, ATP-dependent (EC 3.4.25.-)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.4.25.- or 3.4.25.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RNA2 at UniProt or InterPro

Protein Sequence (187 amino acids)

>Rru_A3599 20S proteasome, A and B subunits (NCBI) (Rhodospirillum rubrum S1H)
MSSSPASPSDNSIVWHGTTILSVRKNGKVVIAGDGQVTFGNTVMKANARKVRPLAGGSVI
AGFAGATADAFTLFERLETKLEQYPGQLTRACVEMAKDWRTDRYLRRLEAMMAVADKGVS
LVLTGTGDVLEPEDGLIGIGSGGPFALAAARALVSEDLDPEVIARRSLAIAADICIYTNH
NLTVEVL