Protein Info for Rru_A3593 in Rhodospirillum rubrum S1H

Annotation: Phosphoribosyl-ATP pyrophosphohydrolase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03188: phosphoribosyl-ATP diphosphatase
  • amino acids 18 to 100 (83 residues), 95.5 bits, E=8.7e-32
• PF01503: PRA-PH
  • amino acids 19 to 103 (85 residues), 67.2 bits, E=6.8e-23

Best Hits

Swiss-Prot: 100% identical to HIS2_RHORT: Phosphoribosyl-ATP pyrophosphatase (hisE) from Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1)

KEGG orthology group: K01523, phosphoribosyl-ATP pyrophosphohydrolase [EC: 3.6.1.31] (inferred from 100% identity to rru:Rru_A3593)

Predicted SEED Role

"Phosphoribosyl-ATP pyrophosphatase (EC 3.6.1.31)" in subsystem Histidine Biosynthesis (EC 3.6.1.31)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (42/46 steps found)
• L-histidine biosynthesis (10/10 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of plant hormones
• Histidine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.1.31

Sequence Analysis Tools

See Q2RNA8 at UniProt or InterPro

Protein Sequence (117 amino acids)

>Rru_A3593 Phosphoribosyl-ATP pyrophosphohydrolase (NCBI) (Rhodospirillum rubrum S1H)
MTDIPPAVSPPPGPEIIDALAAVIASRQGADPATSYTAKLFGRGRGKIVQKFGEEAFEVG
VAALVESPEQVVAESADVLYHLMVLWADVGVTPDRVWAELARRFGTSGIDEKAARKK