Protein Info for Rru_A3592 in Rhodospirillum rubrum S1H

Annotation: Histidine triad (HIT) protein (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 120 PF11969: DcpS_C" amino acids 8 to 109 (102 residues), 57.2 bits, see alignment E=2.3e-19 PF01230: HIT" amino acids 14 to 112 (99 residues), 90.7 bits, see alignment E=7.7e-30

Best Hits

Swiss-Prot: 66% identical to YHIT_AZOBR: Uncharacterized 13.2 kDa HIT-like protein in hisE 3'region from Azospirillum brasilense

KEGG orthology group: None (inferred from 100% identity to rru:Rru_A3592)

Predicted SEED Role

"Bis(5'-nucleosyl)-tetraphosphatase (asymmetrical) (EC 3.6.1.17)" (EC 3.6.1.17)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.1.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RNA9 at UniProt or InterPro

Protein Sequence (120 amino acids)

>Rru_A3592 Histidine triad (HIT) protein (NCBI) (Rhodospirillum rubrum S1H)
MAYDDSNIFARILRGEIPCDKVFEDDHVLAFRDINPQAPVHVLVIPKGPYRSWTEFSATA
SDGEIAALVRAVGTVAADLGVVEQGYRVLSNIGADGGQEVPHLHLHLFGGRRLGRMIAAD