Protein Info for Rru_A3561 in Rhodospirillum rubrum S1H

Annotation: ABC transporter, transmembrane region (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 579 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details transmembrane" amino acids 45 to 71 (27 residues), see Phobius details amino acids 92 to 111 (20 residues), see Phobius details amino acids 134 to 163 (30 residues), see Phobius details amino acids 231 to 250 (20 residues), see Phobius details amino acids 257 to 276 (20 residues), see Phobius details PF00664: ABC_membrane" amino acids 13 to 270 (258 residues), 142.2 bits, see alignment E=2.7e-45 PF00005: ABC_tran" amino acids 356 to 505 (150 residues), 118.3 bits, see alignment E=4.2e-38

Best Hits

KEGG orthology group: K11085, ATP-binding cassette, subfamily B, bacterial MsbA [EC: 3.6.3.-] (inferred from 100% identity to rru:Rru_A3561)

Predicted SEED Role

No annotation

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.-

Use Curated BLAST to search for 3.6.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RNE0 at UniProt or InterPro

Protein Sequence (579 amino acids)

>Rru_A3561 ABC transporter, transmembrane region (NCBI) (Rhodospirillum rubrum S1H)
MRPHLGTIALAVMWMLVLAAATVAVAHMLKPAIDGIVVGSDPQALWGIGLGILLAFAVKA
VSNFFSVVLVAKAGLAAVSDARNRLYRHLSEMDLGFFLAHSASALAARFTVDLHLLRLAV
SNGLTSLGRDLMTLIGLVAYTFWVDWQMALLAYIALPLAIWPVARLGRRIRRIAGRTQRD
LGSLNAQLTQTLRGIRMVKIYGAEEMERARVHRLIAAVQTQSFKAEWTRALVTPIMEGVV
GLAAGAALYYGGARVLAGEVTPGDLTAFLGAVMLAYQPAKRLANLHTILQEGLAAADRMY
HLLDLKPAVAEAPGAPPLRPGPGTVRFDDVTFAYDGGPGPELGDDASGPAAAPPALRGVD
LTLEAGTVVALVGPSGAGKSTLMNLIPRLHDPQRGRVLIDGQDVRAVSFASLWARIGLVS
QDVVVFDDTVRANIAYGRPEASAEEVERAARRAAAHDFIAALPDGYDTRLGEQGVRLSGG
QRQRLCIARAFLKDAPILLLDEPTAALDTESERLVQSALAALMAGRTCLIIAHRLSTIAG
ADVIHVMAEGAVVESGDHAGLLAKDGLYARLHAANRLGA