Protein Info for Rru_A3541 in Rhodospirillum rubrum S1H

Annotation: MutS 1 protein (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 900 929 PF01624: MutS_I" amino acids 52 to 170 (119 residues), 144.1 bits, see alignment E=5.1e-46 TIGR01070: DNA mismatch repair protein MutS" amino acids 52 to 923 (872 residues), 878.6 bits, see alignment E=2.6e-268 PF05188: MutS_II" amino acids 178 to 305 (128 residues), 74.4 bits, see alignment E=2.9e-24 PF05192: MutS_III" amino acids 322 to 619 (298 residues), 152.5 bits, see alignment E=4.9e-48 PF05190: MutS_IV" amino acids 485 to 578 (94 residues), 72 bits, see alignment E=1.1e-23 PF00488: MutS_V" amino acids 674 to 860 (187 residues), 284.1 bits, see alignment E=1.5e-88

Best Hits

Swiss-Prot: 100% identical to MUTS_RHORT: DNA mismatch repair protein MutS (mutS) from Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1)

KEGG orthology group: K03555, DNA mismatch repair protein MutS (inferred from 100% identity to rru:Rru_A3541)

Predicted SEED Role

"DNA mismatch repair protein MutS" in subsystem DNA repair, bacterial MutL-MutS system

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RNG0 at UniProt or InterPro

Protein Sequence (929 amino acids)

>Rru_A3541 MutS 1 protein (NCBI) (Rhodospirillum rubrum S1H)
MLFFADRSPFVRPLSGYAPVTPAAPRSTGSAAAPPPSPAVLDDRSGTEGDVTPMMAQYLA
VKAAHPDCLLFYRMGDFYEMFFEDAVKAAETLDIALTKRGRHAGADIPMCGVPIHSHEGY
LSRLIRAGIKVAICEQMEDPAEARRQRGYKAVVRRDVIRVVTAGTLTEDELLDARAHNYL
AAVVRLRDAVGMAWVDVSTGDLVAQPLAEADIGPALARLAPGEVLMPEKLAGDPALREIL
APLAGRISPLPASRFDSENARKRVEGLFGVKALDGFGGFGRAEVAAIGALIDYVELTQVG
RLPRLSPPRRLSLGAILEIDGATRRNLELTETLGGGRKGSLLARIDCTVTGAGARLLAER
LAAPLTDPAQIGARLDGVGFLVSAERVRGDLRDTLRGCPDIARALSRLSLGRGGPRDLAA
IGEALSRIPALRVLVVGAGLGEPPTELTAALIDLGSHEGLVDLLGRALDADLPLLARDGG
FIRPGYDAGLDELRALRDEGRRLIAGLQARYASETAIPALKIKHNNVLGYFIEVAAGRAD
KLMAAGGPFLHRQTLASQVRFTTVELSELEDKIRGAADKALALEQALFATLCAEVLGCAA
DIARAANGLACLDVAAALADLAARERYARPVVDNSTAFRIHKGRHPVVEAALADQAGPAF
VANDCDLAPDQRLWLLTGPNMAGKSTFLRQNALIAVLAQMGSFVPAESAEIGVIDRLFSR
VGAADDLARGRSTFMVEMVETAAILNQATERSLVILDEIGRGTATYDGLSIAWATVESLH
DATRCRALFATHYHELTALASRLDRLSCHTLRIKEWKDQVVFLHEVGPGAADRSYGIHVA
KLAGLPAAVIARAEQVLAILEKGDASSAATRLADDLPLFAAARPRAGLPTPPPGPHPLAE
ALNAINPDEMTPREALDALYRLKAVMKRE