Protein Info for Rru_A3530 in Rhodospirillum rubrum S1H

Annotation: DNA-directed DNA polymerase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 421 PF00817: IMS" amino acids 41 to 188 (148 residues), 150.9 bits, see alignment E=5.2e-48 PF11798: IMS_HHH" amino acids 201 to 231 (31 residues), 24.9 bits, see alignment (E = 3.5e-09) PF21999: IMS_HHH_1" amino acids 214 to 262 (49 residues), 28.7 bits, see alignment 3e-10 PF11799: IMS_C" amino acids 275 to 377 (103 residues), 90.4 bits, see alignment E=2.1e-29

Best Hits

Swiss-Prot: 54% identical to DPO41_RHILO: DNA polymerase IV 1 (dinB1) from Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)

KEGG orthology group: K02346, DNA polymerase IV [EC: 2.7.7.7] (inferred from 100% identity to rru:Rru_A3530)

Predicted SEED Role

"DNA polymerase IV (EC 2.7.7.7)" in subsystem DNA repair, bacterial (EC 2.7.7.7)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.7

Use Curated BLAST to search for 2.7.7.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RNH1 at UniProt or InterPro

Protein Sequence (421 amino acids)

>Rru_A3530 DNA-directed DNA polymerase (NCBI) (Rhodospirillum rubrum S1H)
MTGLCRDCLCEVLTPSGCCPGCGSARVVRHPGLALLDIAHIDCDAFYASVEKRDNPSLRD
RPLIVGHPGGRGVATTACYIARRFGARSAMPMFKCLELCPEAVVIPPDMAKYKAVSAQVR
AIMLEATHRLEPLSLDEAYLDLSEGEHRFARPPAVSLATIARRVEREIGITVSIGLSSNR
FLAKLASDMNKPQGFTVIDEAEAPALLAPMPVKRLHGVGAATERRLAELGLHTIGDLQGR
PEADLLARFGKIGRALHAHAWGRGGRTISPDRETKSISAETTFERDLSRLPDLARALGPL
SERVARALTRNALAGATVVLKLKTHDFRILTRHARLGDPTARAEVIAGAARRLLERETDG
RRFRLIGVGMADLRPGSEADPPDLFARSPPTARDAPAGKETGDGGSESPQRTASTASTSG
M