Protein Info for Rru_A3522 in Rhodospirillum rubrum S1H

Annotation: Ribosomal protein L20 (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01032: ribosomal protein bL20
  • amino acids 1 to 114 (114 residues), 156.8 bits, E=1.2e-50
• PF00453: Ribosomal_L20
  • amino acids 3 to 109 (107 residues), 156.1 bits, E=1.4e-50

Best Hits

Swiss-Prot: 100% identical to RL20_RHORT: 50S ribosomal protein L20 (rplT) from Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1)

KEGG orthology group: K02887, large subunit ribosomal protein L20 (inferred from 100% identity to rru:Rru_A3522)

MetaCyc: 57% identical to 50S ribosomal subunit protein L20 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"LSU ribosomal protein L20p" in subsystem Ribosome LSU bacterial

Sequence Analysis Tools

See Q2RNH9 at UniProt or InterPro

Protein Sequence (125 amino acids)

>Rru_A3522 Ribosomal protein L20 (NCBI) (Rhodospirillum rubrum S1H)
MSRATNAKTNHARHKKVLDLAKGYRGRNSTNFRIAIEKVEKGLQYAYRDRRAKKRNFRSL
WIQRINAGAREQGLTYSQFINGLIRAGIELDRKILADLAVTEPAAFASLVAQAKAALDTT
AEQAA