Protein Info for Rru_A3513 in Rhodospirillum rubrum S1H

Annotation: chemotaxis sensory transducer (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 585 transmembrane" amino acids 37 to 59 (23 residues), see Phobius details amino acids 214 to 235 (22 residues), see Phobius details PF02203: TarH" amino acids 27 to 196 (170 residues), 59.5 bits, see alignment E=8.3e-20 PF12729: 4HB_MCP_1" amino acids 31 to 206 (176 residues), 37.2 bits, see alignment E=4.4e-13 PF00672: HAMP" amino acids 234 to 281 (48 residues), 31.6 bits, see alignment 3.3e-11 PF00015: MCPsignal" amino acids 386 to 550 (165 residues), 106.4 bits, see alignment E=3e-34

Best Hits

KEGG orthology group: K03406, methyl-accepting chemotaxis protein (inferred from 100% identity to rru:Rru_A3513)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RNI8 at UniProt or InterPro

Protein Sequence (585 amino acids)

>Rru_A3513 chemotaxis sensory transducer (NCBI) (Rhodospirillum rubrum S1H)
MGSGRSVQRGDRLGEETPGAGEKGTIMLRDISIRARLFGVTGALLLLLLGVGGLGLWGMA
SGQGALDDIHENRVIPLAELKQLSDLYARDVVDNTHRILGGTVSYAEGIARLDGALAEAG
RLWRGYQAKPQALGEREASERLTPLLAEADAAAAKLRGLLQKKDKISLLGFANRELPKAI
DPVTEGLRALISLQLDLAQSDYAESAVRQKTTTLAMLALIALAVAVGAVLSLAVLRSITR
PLGALNAAVARLSAGETATPVPGTEARTEIAPLAGAIEQWRTTLVEESRRRAAEARERQA
RDARQQRVMAATARFEDRVAGLVTAMAEGVSGLHRAADTLGATAEQTRVRAATVSGATAT
TSENVETVSAATSQLTASISEIARQVETSSESARGAVRQAEQTNQRVKTLTEAAGRIGDV
VGLITDIASQTNLLALNATIESARAGEAGKGFAVVAGEVKTLAGQTTRATGDIAAHIATV
QAETREAVDALAGIGQAITRVEDLVAGVAAAVAQQDVATREIARSIAQTADSARAVSRTI
AEVNGGAEETGALAGAVARSATRLQADGAALDAAVRDFLGEVKQA