Protein Info for Rru_A3508 in Rhodospirillum rubrum S1H

Annotation: inner-membrane translocator (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 297 transmembrane" amino acids 6 to 30 (25 residues), see Phobius details amino acids 37 to 57 (21 residues), see Phobius details amino acids 63 to 86 (24 residues), see Phobius details amino acids 94 to 116 (23 residues), see Phobius details amino acids 142 to 161 (20 residues), see Phobius details amino acids 191 to 212 (22 residues), see Phobius details amino acids 226 to 251 (26 residues), see Phobius details amino acids 263 to 283 (21 residues), see Phobius details PF02653: BPD_transp_2" amino acids 10 to 271 (262 residues), 116.7 bits, see alignment E=5.4e-38

Best Hits

KEGG orthology group: K01997, branched-chain amino acid transport system permease protein (inferred from 100% identity to rru:Rru_A3508)

Predicted SEED Role

"High-affinity branched-chain amino acid transport system permease protein LivH (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RNJ3 at UniProt or InterPro

Protein Sequence (297 amino acids)

>Rru_A3508 inner-membrane translocator (NCBI) (Rhodospirillum rubrum S1H)
MNGELLFQLLLNGVIVGTLYGVVAMCFVLIYKSTQVVNFAQGEFLLIGAWVCFSLLTDFQ
LPFVLGFLFTLVFMMAFGVLLQVVVLRPMIGEPIISVIMVTIGLSIFLRALVNWVFGQSA
RSFPKIFEAESVTIAGLNVEPAYLMSFAISIIIMIGFYYFFRYSRHGLAMRATAFDQQAA
QSLGISVKRVFAMAWAISAMVSALAGVVMGMVNGVSSALSFVGIKVFPAVILGGLDSIIG
AIVGGLIIGVLENGAEFVDGQYLHWGNMLTIAPFWVLIAILVIKPYGLFGTKKIERV