Protein Info for Rru_A3507 in Rhodospirillum rubrum S1H

Annotation: inner-membrane translocator (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 373 transmembrane" amino acids 30 to 49 (20 residues), see Phobius details amino acids 65 to 87 (23 residues), see Phobius details amino acids 93 to 111 (19 residues), see Phobius details amino acids 117 to 139 (23 residues), see Phobius details amino acids 146 to 165 (20 residues), see Phobius details amino acids 193 to 213 (21 residues), see Phobius details amino acids 244 to 266 (23 residues), see Phobius details amino acids 272 to 291 (20 residues), see Phobius details amino acids 297 to 318 (22 residues), see Phobius details amino acids 332 to 350 (19 residues), see Phobius details PF02653: BPD_transp_2" amino acids 69 to 316 (248 residues), 124.4 bits, see alignment E=2.3e-40

Best Hits

KEGG orthology group: K01998, branched-chain amino acid transport system permease protein (inferred from 100% identity to rru:Rru_A3507)

Predicted SEED Role

"Branched-chain amino acid transport system permease protein LivM (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RNJ4 at UniProt or InterPro

Protein Sequence (373 amino acids)

>Rru_A3507 inner-membrane translocator (NCBI) (Rhodospirillum rubrum S1H)
MATLSLRPCGDFRTSYRADTKIFDTPTSRWAMVGFLCALYGLVILPQAFPPLASLPVLRL
FADGYALSLGIQVCYYAIAALGLNILVGFTGQISLGHAAFFGVGAFSSAWLNTRVGLPVL
VCIPLAGLMSAAAGLLFGAPAARIKGLYLAIATLAAQFIIEDLFVRMDWFTGGSSGAMAD
TPMLGSFAFDNDARYFLLSLSFTIVLFVMAANLMRSRDGRAFVALRDHYLSAEVMGIALT
RYRVMSFGIAAFYAGIGGALYGHYLMFVSAEAFTILLSIQFLGMIIIGGLGSVMGAMLGT
IFMVALPEVMGAVIAALQTTQWGNRPAVINGLPFFREMAIGAAIILFLIFEPDGLAHRWR
LIKTYWKLYPFSH