Protein Info for Rru_A3496 in Rhodospirillum rubrum S1H

Annotation: chemotaxis sensory transducer (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 701 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details transmembrane" amino acids 52 to 75 (24 residues), see Phobius details amino acids 326 to 349 (24 residues), see Phobius details PF00672: HAMP" amino acids 350 to 391 (42 residues), 31.7 bits, see alignment 1.5e-11 PF00015: MCPsignal" amino acids 513 to 659 (147 residues), 93.6 bits, see alignment E=1.3e-30

Best Hits

KEGG orthology group: None (inferred from 100% identity to rru:Rru_A3496)

Predicted SEED Role

"Methyl-accepting chemotaxis protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RNK5 at UniProt or InterPro

Protein Sequence (701 amino acids)

>Rru_A3496 chemotaxis sensory transducer (NCBI) (Rhodospirillum rubrum S1H)
MKASFATAYSPSGGMERSFASPPSPSAASSGRGRFLARLNRSPLAGFSIPIGARMVILVL
LGLLAFGGAVAIHFVSEAASREIEDRRAVLRDIDLGVKDIALNVAGLRLAHQSYATERAE
AVARFRALAEAARGDLGRVGVLAAAAGIGEAGKPTLDRLMTGAAALEAKMATAAAAQETL
GVGEGEGLRGHLSGVIAGIEGELAQWPNVGQIAVKLAQVKRFEQGFLIAPGPDALGRLRK
AANEFDFALMGGPFDADTATRLSSAVGAYTKGLTGYIAAVETSKAAGATLTAALDAFERD
LAEIVALADQETTLARQRFVETRAHMLTLLSWGGGGLLVLFVLASALVGQSIYRPLGRIE
RTMLALAAGESDVEVPGLGRRDEIGRMAEAVAVFKRNAAEVDRLHAERRREGEEAERHRR
AALLDLADGFERSVRHLATDLDRAAHLITDKGRRMADEAGETDEAGRGVADLIAAAAQTL
AEVVTSAHELVRSAGLARDHLAQSQSAITGALAETTEAESRVAALSAAAERIGQVVDLIT
SVAAQTNLLALNATIEAARAGAAGKGFAVVAGEVKTLAQQTNRATEEIAGHVEDIRQAIA
GTVEGIGHISSEVGRVSGLTEALSAAVGAQEVAIGGIGQALDGTAATMTTVTGNLERMGA
VMARSARSALELRETAEGLADQSAGLERELDGFLERIRGTS