Protein Info for Rru_A3486 in Rhodospirillum rubrum S1H

Annotation: Protein of unknown function UPF0016 (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 126 transmembrane" amino acids 31 to 50 (20 residues), see Phobius details amino acids 70 to 94 (25 residues), see Phobius details amino acids 101 to 120 (20 residues), see Phobius details PF01169: GDT1" amino acids 41 to 115 (75 residues), 66.9 bits, see alignment E=8.2e-23

Best Hits

KEGG orthology group: None (inferred from 100% identity to rru:Rru_A3486)

Predicted SEED Role

"COG2119: Predicted membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RNL5 at UniProt or InterPro

Protein Sequence (126 amino acids)

>Rru_A3486 Protein of unknown function UPF0016 (NCBI) (Rhodospirillum rubrum S1H)
MESPLLQAFPNAVAAPTRIVIAFFLTPSDTAMQTLSALLPIFLTVFLAELGDKTQLATML
YASGGQSRPLAIFIAASAALVLSTALAVFVGAMMTRYVEALPLKLIAGVGFIVIGSWTVF
QHYRGA