Protein Info for Rru_A3471 in Rhodospirillum rubrum S1H

Annotation: RecR protein (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 197 TIGR00615: recombination protein RecR" amino acids 4 to 195 (192 residues), 199 bits, see alignment E=2.8e-63 PF21176: RecR_HhH" amino acids 6 to 48 (43 residues), 43.8 bits, see alignment 3.7e-15 PF02132: RecR_ZnF" amino acids 53 to 73 (21 residues), 30.5 bits, see alignment (E = 4.7e-11) PF13662: Toprim_4" amino acids 80 to 169 (90 residues), 68.1 bits, see alignment E=1.3e-22 PF21175: RecR_C" amino acids 172 to 195 (24 residues), 40.4 bits, see alignment (E = 3.1e-14)

Best Hits

Swiss-Prot: 100% identical to RECR_RHORT: Recombination protein RecR (recR) from Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1)

KEGG orthology group: K06187, recombination protein RecR (inferred from 100% identity to rru:Rru_A3471)

MetaCyc: 46% identical to recombination mediator protein RecR (Escherichia coli K-12 substr. MG1655)
RXN0-2606

Predicted SEED Role

"Recombination protein RecR" in subsystem DNA-replication or DNA repair, bacterial RecFOR pathway

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RNN0 at UniProt or InterPro

Protein Sequence (197 amino acids)

>Rru_A3471 RecR protein (NCBI) (Rhodospirillum rubrum S1H)
MSAGEIDRLIGLLARLPGLGPRSARRAALHLLKRRESLMDPLMEALGAVAASVRLCPVCG
TLDTRAPCSICADPRRDGTLICVVRDVADLWALERGGVFSGRYHVLGGLLSAIDGVGPED
LGLDRLAARVAEGPVVEVILALPATVEGQTTAHVIADLIEPKGITVSGLAQGVPVGGELD
YLDDGTLTAALRARRPV