Protein Info for Rru_A3433 in Rhodospirillum rubrum S1H

Annotation: Thioredoxin (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00085: Thioredoxin
  • amino acids 2 to 101 (100 residues), 120.9 bits, E=7.7e-39
• TIGR01068: thioredoxin
  • amino acids 5 to 102 (98 residues), 128.7 bits, E=4e-42
• PF00578: AhpC-TSA
  • amino acids 16 to 89 (74 residues), 27.9 bits, E=6.8e-10
• PF13098: Thioredoxin_2
  • amino acids 18 to 99 (82 residues), 39.5 bits, E=2.2e-13
• PF13905: Thioredoxin_8
  • amino acids 19 to 60 (42 residues), 29.2 bits, E=3.3e-10
• PF14595: Thioredoxin_9
  • amino acids 25 to 93 (69 residues), 26.6 bits, E=1.8e-09

Best Hits

Swiss-Prot: 97% identical to THIO_RHORU: Thioredoxin (trxA) from Rhodospirillum rubrum

KEGG orthology group: K03671, thioredoxin 1 (inferred from 100% identity to rru:Rru_A3433)

MetaCyc: 62% identical to reduced thioredoxin 1 (Escherichia coli K-12 substr. MG1655)
RXN-20161 [EC: 1.8.4.16]

Predicted SEED Role

"FIG149041: Thioredoxin"

MetaCyc Pathways

• periplasmic disulfide bond reduction (1/2 steps found)
• cytochrome c biogenesis (system I type) (3/11 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.8.4.16

Sequence Analysis Tools

See Q2RNR8 at UniProt or InterPro

Protein Sequence (104 amino acids)

>Rru_A3433 Thioredoxin (NCBI) (Rhodospirillum rubrum S1H)
MKQVSDASFEEDVLKADGPVLVDFWAEWCGPCRQIAPALEELATALGDKVTVAKINIDEN
PQTPSKYGVRGIPTLMIFKDGQVAATKIGALPKTKLFEWVEASV