Protein Info for Rru_A3424 in Rhodospirillum rubrum S1H

Annotation: Orotidine-5'-phosphate decarboxylase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 247 PF00215: OMPdecase" amino acids 10 to 235 (226 residues), 181.2 bits, see alignment E=1.5e-57 TIGR01740: orotidine 5'-phosphate decarboxylase" amino acids 12 to 236 (225 residues), 162.7 bits, see alignment E=5e-52

Best Hits

Swiss-Prot: 100% identical to PYRF_RHORT: Orotidine 5'-phosphate decarboxylase (pyrF) from Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1)

KEGG orthology group: K01591, orotidine-5'-phosphate decarboxylase [EC: 4.1.1.23] (inferred from 100% identity to rru:Rru_A3424)

Predicted SEED Role

"Orotidine 5'-phosphate decarboxylase (EC 4.1.1.23)" in subsystem De Novo Pyrimidine Synthesis (EC 4.1.1.23)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.1.23

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RNS7 at UniProt or InterPro

Protein Sequence (247 amino acids)

>Rru_A3424 Orotidine-5'-phosphate decarboxylase (NCBI) (Rhodospirillum rubrum S1H)
MPMAQMTQNPVFVAIDTTVVGDATTLAARLHDEVGGIKLGLEFFARNGHKGVKEVCRAGA
LPLFLDLKFHDIPNTVAGAVRAVMPLAPALLNVHACGGRAMMIAAREAAQSEALALGIAP
PKMIAVTVLTSMDDDDLGGTGVAGGVLDQVRRLAALTRDAGLDGVVCSAREARVLRADLG
DDFLLVTPGVRPLWSTTNDQKRVVTPQEAMAEGADVLVIGRPITGATDPAQAARLIAGEI
VGWDVGI