Protein Info for Rru_A3403 in Rhodospirillum rubrum S1H

Annotation: Sulphate transport system permease protein 1 (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 356 TIGR00968: sulfate ABC transporter, ATP-binding protein" amino acids 3 to 245 (243 residues), 367.1 bits, see alignment E=1.9e-114 PF00005: ABC_tran" amino acids 21 to 166 (146 residues), 125.2 bits, see alignment E=6e-40 PF13304: AAA_21" amino acids 115 to 200 (86 residues), 27 bits, see alignment E=8.4e-10 PF08402: TOBE_2" amino acids 280 to 348 (69 residues), 21.2 bits, see alignment E=5.3e-08 PF12857: TOBE_3" amino acids 292 to 348 (57 residues), 37.8 bits, see alignment E=2.8e-13

Best Hits

Swiss-Prot: 65% identical to CYSA_XANAC: Sulfate/thiosulfate import ATP-binding protein CysA (cysA) from Xanthomonas axonopodis pv. citri (strain 306)

KEGG orthology group: K02045, sulfate transport system ATP-binding protein [EC: 3.6.3.25] (inferred from 100% identity to rru:Rru_A3403)

Predicted SEED Role

"Sulfate and thiosulfate import ATP-binding protein CysA (EC 3.6.3.25)" in subsystem Cysteine Biosynthesis (EC 3.6.3.25)

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.25

Use Curated BLAST to search for 3.6.3.25

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RNU8 at UniProt or InterPro

Protein Sequence (356 amino acids)

>Rru_A3403 Sulphate transport system permease protein 1 (NCBI) (Rhodospirillum rubrum S1H)
MRIDIENIRKTFRHGTAAALAGVDLAVASGELVALLGPSGSGKTTLLRIIAGLEFPDGGR
VLFDGEDASALPVRDRHVGFVFQQYALFRHMTVLENVAFGLRVRPRGTRPSDGEIDRRVR
DLLTLVQLEGLEGRYPAQLSGGQRQRVALARALAIEPGVLLLDEPFGALDARVRKDLRRW
LRDLHDRTGHTTVFVTHDQEEALELADRVVVFSQGRIEQAGSPVEVYDRPATPFVYDFLG
SVNRLPVEVRDGHVWLEGHAQPLANGQAVDSTGLFTLYARPHDLGIADQTLPAGDALPGI
VAAVRQAGAVVRLDVRVAGLDHLVEVEVSAGDERWRAWKTGSPVALVPARFDLFPR