Protein Info for Rru_A3374 in Rhodospirillum rubrum S1H

Annotation: Putative diguanylate cyclase (GGDEF domain) with PAS/PAC sensor domain (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 492 TIGR00229: PAS domain S-box protein" amino acids 52 to 165 (114 residues), 24.6 bits, see alignment E=2.3e-09 amino acids 205 to 327 (123 residues), 44.8 bits, see alignment E=1.2e-15 PF13426: PAS_9" amino acids 54 to 157 (104 residues), 21.3 bits, see alignment E=8.2e-08 amino acids 215 to 319 (105 residues), 26.6 bits, see alignment E=1.8e-09 PF00989: PAS" amino acids 206 to 317 (112 residues), 22.9 bits, see alignment E=2.2e-08 PF08448: PAS_4" amino acids 214 to 322 (109 residues), 42.9 bits, see alignment E=1.5e-14 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 327 to 490 (164 residues), 166.8 bits, see alignment E=3.5e-53 PF00990: GGDEF" amino acids 331 to 488 (158 residues), 149.7 bits, see alignment E=1.9e-47

Best Hits

KEGG orthology group: None (inferred from 100% identity to rru:Rru_A3374)

Predicted SEED Role

"diguanylate cyclase (GGDEF domain) with PAS/PAC sensor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RNX7 at UniProt or InterPro

Protein Sequence (492 amino acids)

>Rru_A3374 Putative diguanylate cyclase (GGDEF domain) with PAS/PAC sensor domain (NCBI) (Rhodospirillum rubrum S1H)
MRRLVRSRNGTVGRVSEGVRGGHKRLRGANRPWPGVRRTRAADAMGELIDRLLNGVLIVD
STLRPLYANREFLRLLGLPDADTLLRPAGLERFLPEDNRQVLLDMTHRLFSHQSQRASQR
LEVVRADNATLWLDFSAALGRWAERDVVQIAVVDATERVTHESELEFNRAQLENQAVELV
ALAEDLNAEREQLETARLDADEGRRFLQTLIATIPNPFFHQDLEGRIRGCNAAFAALHGR
DHRTDMFGLTVADLTDAAFSSRTERLDAELMAKGGNVSYEAVFADAEGRARTMIYNKAVL
TDAAGQAVGLVAVITDITEQKRMEEALRRLATTDPLTGALNRRAFMEAARRDLALAQRHG
EPVTVALADIDHFKRVNDQHGHATGDEALKTFVATVHGALRASDVLGRMGGEEFALILPH
TALASAMLLADRLRQTLANLRVPCPSGEVEFTVSIGLAELGTHGTTIDTLLQAADEALYR
AKSAGRNRVIAA