Protein Info for Rru_A3362 in Rhodospirillum rubrum S1H

Annotation: Uroporphyrin-III C-methyltransferase-like (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 291 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details TIGR01469: uroporphyrinogen-III C-methyltransferase" amino acids 20 to 255 (236 residues), 271.4 bits, see alignment E=4e-85 PF00590: TP_methylase" amino acids 22 to 232 (211 residues), 159.9 bits, see alignment E=4.3e-51

Best Hits

Swiss-Prot: 61% identical to SUMT_SINSX: Uroporphyrinogen-III C-methyltransferase (cobA) from Sinorhizobium sp.

KEGG orthology group: K02303, uroporphyrin-III C-methyltransferase [EC: 2.1.1.107] (inferred from 100% identity to rru:Rru_A3362)

MetaCyc: 61% identical to CobA (Pseudomonas denitrificans (nom. rej.))
Uroporphyrinogen-III C-methyltransferase. [EC: 2.1.1.107]; 2.1.1.107 [EC: 2.1.1.107]

Predicted SEED Role

"Uroporphyrinogen-III methyltransferase (EC 2.1.1.107)" in subsystem Coenzyme B12 biosynthesis or Dissimilatory nitrite reductase or Experimental tye or Heme and Siroheme Biosynthesis (EC 2.1.1.107)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.107

Use Curated BLAST to search for 2.1.1.107

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RNY9 at UniProt or InterPro

Protein Sequence (291 amino acids)

>Rru_A3362 Uroporphyrin-III C-methyltransferase-like (NCBI) (Rhodospirillum rubrum S1H)
MKQSFAFSRLGLALPPVEPGWVWLVGAGPGDPGLLTVLAAHALAEADVVVHDALIDGRVL
GLAREEAVLIPAGKRGGRPSHSQPDISARLVDLARAGKRVVRLKGGDPFVFGRGAEEART
LVAAGVPFRIVPGVTAGVGGLAYAGIPATTRDTNATVTFVTGHAATGEVPDTFDWEALAR
LPVLVFYMALKTLDVIAARLMEHGRSGETPVAFVSDATTAAQRVHITTLAQAVTERDRLG
IAPPALVVLGDVVPLARDLAWWSPPKQGCGGEVWPDPMQSIPGSATPLIGD