Protein Info for Rru_A3320 in Rhodospirillum rubrum S1H

Annotation: Cytidyltransferase-related (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 290 PF02569: Pantoate_ligase" amino acids 14 to 288 (275 residues), 328.7 bits, see alignment E=1.2e-102 TIGR00018: pantoate--beta-alanine ligase" amino acids 15 to 289 (275 residues), 288.8 bits, see alignment E=3.5e-90 TIGR00125: cytidyltransferase-like domain" amino acids 37 to 92 (56 residues), 32 bits, see alignment E=1.1e-11

Best Hits

Swiss-Prot: 100% identical to PANC_RHORT: Pantothenate synthetase (panC) from Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1)

KEGG orthology group: K01918, pantoate--beta-alanine ligase [EC: 6.3.2.1] (inferred from 100% identity to rru:Rru_A3320)

Predicted SEED Role

"Pantoate--beta-alanine ligase (EC 6.3.2.1)" in subsystem Coenzyme A Biosynthesis (EC 6.3.2.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.2.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RP31 at UniProt or InterPro

Protein Sequence (290 amino acids)

>Rru_A3320 Cytidyltransferase-related (NCBI) (Rhodospirillum rubrum S1H)
MISDSLEGVRALPIARSVSELRAVVDGWKAEGLRVGLVPTMGALHAGHLSLVRLALSKVD
RVVASVFVNPTQFGPNEDFAAYPRDEAADAAKLGGAGAHLLYAPDVAGMYPPGFSTTITV
SGVSSGLCGDLRPGHFQGVATVVAKLFLRVRPDVAVFGEKDYQQLLVLKRLVNDLDLAIE
VIGAPIVRETDGLALSSRNAYLSAEQRALAPGLYRTLRRVGADILGGGRVDDCLAWGIDE
LKALGFGPVDYLDLRDGATLERLDDAPEGPGRLLCAAYLGKTRLIDNIGV