Protein Info for Rru_A3319 in Rhodospirillum rubrum S1H

Annotation: Xanthine-guanine phosphoribosyltransferase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00156: Pribosyltran
  • amino acids 32 to 156 (125 residues), 51.6 bits, E=3.5e-18

Best Hits

Swiss-Prot: 57% identical to XGPT_DESAG: Xanthine phosphoribosyltransferase (gpt) from Desulfovibrio alaskensis (strain G20)

KEGG orthology group: K00769, xanthine phosphoribosyltransferase [EC: 2.4.2.22] (inferred from 100% identity to rru:Rru_A3319)

Predicted SEED Role

"Xanthine-guanine phosphoribosyltransferase (EC 2.4.2.22)" in subsystem Purine conversions (EC 2.4.2.22)

MetaCyc Pathways

• superpathway of purine nucleotide salvage (13/14 steps found)
• guanine and guanosine salvage I (2/2 steps found)
• xanthine and xanthosine salvage (2/2 steps found)
• superpathway of guanine and guanosine salvage (2/3 steps found)
• guanine and guanosine salvage II (1/2 steps found)

KEGG Metabolic Maps

• Purine metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.4.2.22

Use Curated BLAST to search for 2.4.2.22

Sequence Analysis Tools

See Q2RP32 at UniProt or InterPro

Protein Sequence (185 amino acids)

>Rru_A3319 Xanthine-guanine phosphoribosyltransferase (NCBI) (Rhodospirillum rubrum S1H)
METKDYASAVYIPIAWELFHRDTRSLAHKLMAKGPFKGIVAITRGGLIPSSIIARELDIR
VIESVGVATYDDRTQSTGVQILKELNRDLVGDGEGWLVVDDLVDSGVTARAVKAMLPKAH
MATVYAKPEGQKETDTFVVAVRQDVWLLFPWDADLQPNEPLVRRQRDLEVDDVSIGRPDD
MPSQG