Protein Info for Rru_A3296 in Rhodospirillum rubrum S1H

Annotation: PAS/PAC Sensor Signal Transduction Histidine Kinase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 PF00989: PAS" amino acids 10 to 61 (52 residues), 32.5 bits, see alignment 2.7e-11 TIGR00229: PAS domain S-box protein" amino acids 11 to 54 (44 residues), 31.7 bits, see alignment 7.3e-12 amino acids 301 to 401 (101 residues), 43.5 bits, see alignment E=1.6e-15 PF13188: PAS_8" amino acids 11 to 55 (45 residues), 30.1 bits, see alignment 1.1e-10 amino acids 285 to 324 (40 residues), 18 bits, see alignment 7.7e-07 PF08448: PAS_4" amino acids 16 to 81 (66 residues), 27 bits, see alignment E=1.6e-09 PF13426: PAS_9" amino acids 20 to 56 (37 residues), 20.3 bits, see alignment 2e-07 amino acids 301 to 395 (95 residues), 37.9 bits, see alignment E=6.3e-13 PF00512: HisKA" amino acids 418 to 483 (66 residues), 34.5 bits, see alignment E=5.9e-12 PF02518: HATPase_c" amino acids 528 to 647 (120 residues), 82.5 bits, see alignment E=1.1e-26

Best Hits

KEGG orthology group: None (inferred from 100% identity to rru:Rru_A3296)

Predicted SEED Role

"Signal transduction histidine kinase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RP54 at UniProt or InterPro

Protein Sequence (650 amino acids)

>Rru_A3296 PAS/PAC Sensor Signal Transduction Histidine Kinase (NCBI) (Rhodospirillum rubrum S1H)
MDTSPSIDQDFRTLVEVATDAIMVIGGDGTILYANDAAGELFGHRPADLLGLPFGHPAIH
GQISELDIHGRDRRRVAEMRVSSVHWEGEASHVIILRDVSDRVRMAASLRDRLAFEQLLL
EISATFARARSSERQTASAQALGLFCDYVRAEQAFLLARTETGAFEIIAFYPAGERGNDR
ALSPALGEEVEACLRDNRVQALVGTTLAASGDGRTDDSARWIGILPLTDGEEGFGALCLM
RATPPGFGAAAYDLESLRPAPTLFLDALRRMRLEDLLTRAMVKQASVFRQLVEGLCLVRG
RRVVQANQALADMMGYQVDDMPGLETKAFFATEESYEAVGEKGYQDVREGRLYSAEHLFK
RRTGERFWGELKGAPVEGEDNADGESVWVLRDITDLREAAARKQQLIDELSRSNAELERF
AFIASHDLKEPVRMVASYVNLLSKRYGNSFDGEGREFLNFALEGARRIHQMIEGILDYAR
IEASSPDLDAVALEGPLDRALASLADTLRDSEARITVQRPLPTVLAVPSEMERVFVNLIG
NAVKFAKPDQSPHIDIMVETCPSPPKGKDQGSPLCHITIRDAGIGIPEAAREKVFDIFWR
LHGREKYDGTGLGLAIVKRIIDRRGGRIWIESREGTGTTIHILQPLAPSP