Protein Info for Rru_A3272 in Rhodospirillum rubrum S1H

Annotation: Protein of unknown function DUF6, transmembrane (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 314 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 42 to 63 (22 residues), see Phobius details amino acids 82 to 103 (22 residues), see Phobius details amino acids 110 to 131 (22 residues), see Phobius details amino acids 140 to 158 (19 residues), see Phobius details amino acids 164 to 182 (19 residues), see Phobius details amino acids 191 to 210 (20 residues), see Phobius details amino acids 222 to 247 (26 residues), see Phobius details amino acids 259 to 277 (19 residues), see Phobius details amino acids 284 to 307 (24 residues), see Phobius details PF00892: EamA" amino acids 16 to 153 (138 residues), 63.5 bits, see alignment E=2.4e-21 amino acids 164 to 299 (136 residues), 67 bits, see alignment E=2e-22

Best Hits

KEGG orthology group: None (inferred from 100% identity to rru:Rru_A3272)

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RP78 at UniProt or InterPro

Protein Sequence (314 amino acids)

>Rru_A3272 Protein of unknown function DUF6, transmembrane (NCBI) (Rhodospirillum rubrum S1H)
MDLGYLKSKESGFIAGMILCTAFMGSSFPSGKYLISEEAMPAFYAGGWRFLLAGGLILAF
CAAKDGLGAILPASGGSVIKGALFVLVVGCLQTAGTMGFLNLALTTLSASMASLLLFTNP
LWVAILAHFALGETLSWHKVVALVCGILGVSLCLGGGADHGLGGIVIALAGSLCWALCTL
ISKKHKFDKSVFVFTGWQLTLGALVMLAISKLSGEAYDIDRITGWGIACFIWLVGPASIG
SFGLWFTALSRRGATVTSSYLFLVPLFSAVFSMMVLGEAVSPHSLIGGAIIIVALWLINL
PQTVSAVWRERLGL