Protein Info for Rru_A3244 in Rhodospirillum rubrum S1H

Annotation: H+-transporting two-sector ATPase, B/B' subunit (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 161 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details PF02326: YMF19" amino acids 2 to 76 (75 residues), 37.8 bits, see alignment E=2.8e-13 PF00430: ATP-synt_B" amino acids 13 to 142 (130 residues), 114.6 bits, see alignment E=3.5e-37

Best Hits

Swiss-Prot: 100% identical to ATPX_RHORU: ATP synthase subunit b' (atpG) from Rhodospirillum rubrum

KEGG orthology group: K02109, F-type H+-transporting ATPase subunit b [EC: 3.6.3.14] (inferred from 100% identity to rru:Rru_A3244)

Predicted SEED Role

"ATP synthase F0 sector subunit b' (EC 3.6.3.14)" (EC 3.6.3.14)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.14

Use Curated BLAST to search for 3.6.3.14

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RPA6 at UniProt or InterPro

Protein Sequence (161 amino acids)

>Rru_A3244 H+-transporting two-sector ATPase, B/B' subunit (NCBI) (Rhodospirillum rubrum S1H)
MPQFDPSSFPSQIVWLVIALVAMYFVMSRLAIPRLAEVLEQRQRLINDDLKQAEALKAET
EAAIAAYETALAEARARAHDEIRAVTEAAAKAAEARNAEVAKALNTRIKDGEARIVQARD
EALTHVREVAGAVASDIVGKLAGLRVDDAALTAAVAAAIKE