Protein Info for Rru_A3214 in Rhodospirillum rubrum S1H

Annotation: O-succinylhomoserine sulfhydrylase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 413 PF01053: Cys_Met_Meta_PP" amino acids 27 to 408 (382 residues), 402 bits, see alignment E=2e-124 TIGR01325: O-succinylhomoserine sulfhydrylase" amino acids 27 to 408 (382 residues), 531.8 bits, see alignment E=3.5e-164 PF00155: Aminotran_1_2" amino acids 85 to 211 (127 residues), 24.6 bits, see alignment E=1.4e-09

Best Hits

Swiss-Prot: 53% identical to METZ_MYCTU: O-succinylhomoserine sulfhydrylase (metZ) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: K10764, O-succinylhomoserine sulfhydrylase [EC: 2.5.1.-] (inferred from 100% identity to rru:Rru_A3214)

Predicted SEED Role

"O-acetylhomoserine sulfhydrylase (EC 2.5.1.49)" in subsystem Methionine Biosynthesis (EC 2.5.1.49)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.-, 2.5.1.49

Use Curated BLAST to search for 2.5.1.- or 2.5.1.49

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RPD6 at UniProt or InterPro

Protein Sequence (413 amino acids)

>Rru_A3214 O-succinylhomoserine sulfhydrylase (NCBI) (Rhodospirillum rubrum S1H)
MPRESDFSPAQSPSLEAPTGPATWRADTLLVRGGLARTGLNETSEALFLNSGYVYPNAEE
AEAAFDGTLERYVYSRFRNPTISVFEERLAALEGAPVCKATASGMAAVTSALLCQVRAGD
RVVAARDLFGSCSWVIGDLLAQYGVSAEFVDTENLDAWAQALAKPTRAVFLETPSNPTLR
IVDLKGVCDLAHAAGATVVVDNAFATPLLQRPRDFGADVVVHSATKWIDGQGRCLGGAVL
CDEAFNETYLGPFLRHTGPCLAPFNAWVMLKGLETLSLRINRHSATALTLAGLIEGHPAV
ARALYPGLASHPRHALAQSQMKAGGGVIALSLKGGRASAYRFLNALSIVDISNNLGDAKS
LACHPWTTTHQRLSPEEKLIQGIDEGLIRFSVGLEDPEDLAADIGAALDAAGG