Protein Info for Rru_A3201 in Rhodospirillum rubrum S1H

Annotation: ABC transporter component (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 359 PF00005: ABC_tran" amino acids 20 to 166 (147 residues), 121.4 bits, see alignment E=6.6e-39 PF08402: TOBE_2" amino acids 281 to 346 (66 residues), 25.5 bits, see alignment E=1.8e-09

Best Hits

Swiss-Prot: 43% identical to POTA_MARHV: Spermidine/putrescine import ATP-binding protein PotA (potA) from Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8)

KEGG orthology group: K02010, iron(III) transport system ATP-binding protein [EC: 3.6.3.30] (inferred from 100% identity to rru:Rru_A3201)

Predicted SEED Role

"ABC transporter ATP-binding protein"

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.30

Use Curated BLAST to search for 3.6.3.30

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RPE9 at UniProt or InterPro

Protein Sequence (359 amino acids)

>Rru_A3201 ABC transporter component (NCBI) (Rhodospirillum rubrum S1H)
MARLSLDGVSRQFGARTAVDRVSLTLEPGTFLALLGPSGCGKTTLLRLIAGFDRPDGGTI
TLGDGIVASDTAFVPPERRGVGMVFQSYALWPHMTVAENVAYALKIRGVARAERARIVQR
CLDQVGLGTLGGRLPAALSGGQRQRVALARCLAMNPAILLLDEPLANLDAHLRESMQREF
RAFHAKTGATMVYVTHDQAEALSLADKVAVMDGGVLQQVATPAELYRRPATDMVARFVGR
GMVLPAHLGRATAGGGAVAATLFGQAISVDSPAHPAGPARLCLRSEDLSLTGPDTPEGLG
CTVCDTVFHGDHFALDVRPQAAPETVLRVRLTQAPPPQGSPVTLRIGGGWILPLANGGC