Protein Info for Rru_A3194 in Rhodospirillum rubrum S1H

Annotation: SMF protein (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 374 PF21102: DprA_N" amino acids 9 to 73 (65 residues), 100.6 bits, see alignment E=5.6e-33 PF02481: DNA_processg_A" amino acids 78 to 279 (202 residues), 233.2 bits, see alignment E=2.8e-73 TIGR00732: DNA protecting protein DprA" amino acids 79 to 286 (208 residues), 214.6 bits, see alignment E=5e-68 PF17782: DprA_WH" amino acids 309 to 368 (60 residues), 57.5 bits, see alignment E=1.7e-19

Best Hits

KEGG orthology group: K04096, DNA processing protein (inferred from 100% identity to rru:Rru_A3194)

Predicted SEED Role

"Rossmann fold nucleotide-binding protein Smf possibly involved in DNA uptake" in subsystem Conserved gene cluster associated with Met-tRNA formyltransferase

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RPF6 at UniProt or InterPro

Protein Sequence (374 amino acids)

>Rru_A3194 SMF protein (NCBI) (Rhodospirillum rubrum S1H)
MAPAARPLTASEKLDRLRLLRTENVGPITWRRLMARYGSAASALDALPDLARRGGGAKPL
RICPLAAAKREMDTLAGLDATMVFLDEADYPPALAAIEDAPPMFCLRGALGLLGKPMVAI
VGARNASANGQRLAERLAADLGRSGLVVVSGMARGVDSAAHVGALESGTLAVVAGGVDVV
YPPENDGLYRRLITEGAVISETAPGEQPQARHFPRRNRIVSGLSLGVIVVEGAPRSGSLI
TARLAADQGREVMAVPGSPLDSRAQGPNGLIKNGAALIEDAADVLRILSPLIARPMAEDK
PQNYASAPPSPIADSTIDAARPRVIEALGMSPVGVDEVIRLCTLPPAVVAVVLLELELAG
RLDRLVGNRVCLIA