Protein Info for Rru_A3190 in Rhodospirillum rubrum S1H

Annotation: Aspartate carbamoyltransferase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02729: OTCace_N
  • amino acids 12 to 154 (143 residues), 151.2 bits, E=2.4e-48
• TIGR00670: aspartate carbamoyltransferase
  • amino acids 12 to 309 (298 residues), 309.6 bits, E=1e-96
• PF00185: OTCace
  • amino acids 162 to 308 (147 residues), 80.6 bits, E=1.3e-26

Best Hits

Swiss-Prot: 100% identical to PYRB_RHORT: Aspartate carbamoyltransferase (pyrB) from Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1)

KEGG orthology group: K00609, aspartate carbamoyltransferase catalytic subunit [EC: 2.1.3.2] (inferred from 100% identity to rru:Rru_A3190)

Predicted SEED Role

"Aspartate carbamoyltransferase (EC 2.1.3.2)" in subsystem De Novo Pyrimidine Synthesis (EC 2.1.3.2)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (42/46 steps found)
• superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (16/18 steps found)
• UMP biosynthesis II (6/6 steps found)
• superpathway of pyrimidine ribonucleotides de novo biosynthesis (8/9 steps found)
• UMP biosynthesis I (5/6 steps found)
• UMP biosynthesis III (5/6 steps found)

KEGG Metabolic Maps

• Alanine and aspartate metabolism
• Pyrimidine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.3.2

Sequence Analysis Tools

See Q2RPG0 at UniProt or InterPro

Protein Sequence (319 amino acids)

>Rru_A3190 Aspartate carbamoyltransferase (NCBI) (Rhodospirillum rubrum S1H)
MSAILFPEYTHRHLLGIEGLVPVEVTALLDRAEIYANRNRSANKVSDEMRGRTVINLFFE
NSTRTRTSFELAARRLGADVINMQVGSSSVAKGETLIDTAVTLNAMHPDVLVVRHAESGA
AALLAQKVNCAVINAGDGAHEHPTQALLDALTIRRRKGRLGGLDVAICGDVLHSRVARSN
IHLLTLMGARVRVVGPRPLIPSGIGELGVDIFHDMREGLRGVDIVMMLRIQMERMQGNFI
PSVREYFRYFGLDREKLALAKPDALIMHPGPMNRGVEIDSDVADDFERSVIREQVEMGVA
VRMAVLEVLSGNLASMETA